KEGG   Synechocystis sp. PCC 6803: sll0166Help
Entry
sll0166           CDS       T00004                                 

Gene name
hemD
Definition
(GenBank) uroporphyrin-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00860  Porphyrin and chlorophyll metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sll0166 (hemD)
Enzymes [BR:syn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     sll0166 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     sll0166 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: BAA10063
CyanoBase: sll0166
CYORF: sll0166
UniProt: Q55562
Position
complement(2318011..2319627)
Genome map
AA seq 538 aa AA seqDB search
MAEKLPHPQCLGVPGRSPRRESNLIFTMLSTDSRAKVYLMGAGLGPVAYLTQRAIAVLGR
ANVVIYDALVSQELFDLLPPDCERIFVGKRGGQPSTPQAKINQLLVDHYRRGKQVVRLKS
GDPWIFGRIMPELATLVTHHCAYEVVPGISSAIAGAGLASIPLTAKDSGAGFFVMDGHDP
HRWPWPALAQLPTLVILMGTKNLSLLVNELVRAGKSPHTPMAVIKNAGRPEQQTWEGTLA
DMVEKTQGQSLAPAVIVIGDVVSQRIIPALPPLPLTEKTILVTRAADQASQFTELLHQQG
ATVLAMAALEIVPPKDWQPLDQAIAKLGDFDWLILTSANGVEFFFQRLQHHGLDSRALAG
LKLAVVGKKTAQSLEKFGLKPDFIPPDFIADALVEHFPHSPAGLKILFPRVESGGRAQLV
QELSQKQALVTEVPSYQSACPGHMPEEVWQSIVNQTVDVITFASSKTVSHFRQLLAQTSQ
ANGYQDWRSLINHCQIASIGPQTSERCLRELGRVDIEATEYTLEGLTGAITNYVYQNP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaactacctcacccacaatgccttggtgtccccggccgatcgccccggcgc
gaaagtaacctaatttttacaatgctaagtacagattccagagccaaagtttatctgatg
ggggctggcttggggcccgtggcctacctgactcaaagggcgatcgccgtgttgggtagg
gcaaatgtggtaatttatgacgccttggtgtcccaggagctttttgatctcctgccgcca
gattgtgagcgaattttcgtcggcaaacgggggggacaacccagcactccccaggccaaa
attaatcagttattggtggaccattaccgacggggcaaacaggtagtacggctgaaaagc
ggtgatccctggatttttggccgcattatgccggaattggcaaccctagtgacccaccat
tgtgcctatgaagtagtaccaggaatttcctcggcgatcgccggggcaggactagcaagc
attcccctcacagccaaagatagcggggcgggtttttttgtcatggacggccatgatccc
caccgttggccttggcctgccctggcccaattgcccactttggtaattctcatggggacc
aaaaatttgtcgttgttggtcaatgagttagtccgagcaggtaaatctccccacaccccc
atggcagtgattaaaaatgccggcagaccggaacagcaaacctgggaaggaaccctagct
gatatggtggaaaaaacccaaggacagtccctcgccccagcggtaattgtcattggagat
gttgttagtcaaaggattattcccgccttgcctcccctgcccctgaccgaaaaaactatt
ctggttaccagggccgccgaccaagcgagccagtttaccgagcttttgcaccagcaaggg
gccaccgtcttagccatggctgccctggaaattgtgccccccaaggactggcaacccctc
gaccaggcgatcgccaagttgggggattttgactggctaattctgacttccgccaatggg
gtggagttcttttttcaaagattgcaacaccacggtttggacagtagggccctggcggga
ttaaagttggcggtagtgggcaaaaagaccgcccaaagcctagaaaaatttggtctcaag
ccagatttcattcccccggatttcattgccgatgccctggtggaacattttccccactcc
ccagcaggactaaaaatactttttccccgggtggaaagtggtggccgggcccaattagtc
caagaattgagccaaaaacaagccttggttacggaagtcccctcctatcaatccgcctgc
cctggccatatgcccgaagaagtgtggcaaagtatcgttaatcaaacggtggatgtgatc
acctttgccagttccaaaaccgtcagccattttcggcaactgttggcccagactagccaa
gctaacggttaccaagattggcgttccctaattaaccattgccaaatcgcttccattggc
ccccaaacttccgaacgctgtttacgggaattgggtcgggtggacattgaagcaacggag
tacaccctagaaggcctaaccggggccattactaattatgtttaccaaaatccgtga

DBGET integrated database retrieval system