KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0678Help
Entry
SYNPCC7002_A0678  CDS       T00664                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
syp  Synechococcus sp. PCC7002
Brite
Enzymes [BR:syp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SYNPCC7002_A0678 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
707723..708391
Genome map
AA seq 222 aa AA seqDB search
MDLPPTNDFCADPTVALRQRMVKQQIIARGVNDPAVLAALQQVPRHRFVPDSLQNLAYAD
QPLTIGYGQTISQPYIVAYMTEAAHLTPSSKVLEIGTGCGYQAAILAEIAQEVFTVEVVP
ELARQARDRLEALGYQNIHYKIGDGYQGWSEFAPYDAILVTAAPDHRPQPLLQQLAVGGH
LVIPVGTVGQRLEVLHKTSTDLEMEKAIAVRFVPLQGHSYGF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatcttccacccaccaatgatttctgtgccgatcccaccgttgctttacgtcagcgg
atggttaagcagcaaattatcgccaggggcgtgaacgatccagctgtcttagccgcgctc
cagcaagtgccccggcatcgctttgtgcctgattctctccaaaatctcgcctacgccgat
caaccccttaccatcggctatggccaaactatttcccagccctatatcgtcgcctacatg
accgaggcggcccacctgacgcccagcagcaaagttttagaaattggtacggggtgcggt
tatcaagcggcgatcctcgccgaaattgcccaggaagtttttaccgttgaagttgtgccc
gaattagcccggcaagcccgcgatcgcctcgaagcattgggctatcagaatattcactac
aagattggtgacggttaccagggctggtcagaatttgctccctacgacgcgatccttgtt
acggcggccccagaccatcggccccaaccgttactgcaacaattggccgtgggcggtcac
ctggtaatacctgtgggcaccgtcggccaacgccttgaagtcctccacaaaaccagcact
gacttggaaatggaaaaggcgatcgctgtgcggtttgtgccactccagggtcacagctac
ggattttga

DBGET integrated database retrieval system