KEGG   Thermoplasma acidophilum: Ta0629Help
Entry
Ta0629            CDS       T00037                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
tac  Thermoplasma acidophilum
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ta0629
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Ta0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660031..660933
Genome map
AA seq 300 aa AA seqDB search
MPTSIPKEELMAPGHTACHGCGATLAMRYVLKALGEKTVVSVPASCWAVIPGAMPFRTLD
VPMVYTPFAATGASISGLREGLDIQGKSDYNVVGFAGDGGTADIGLQGLSGAMERGHNVF
YIMYDNEGYMNTGVQRSGSTPYGARTTTTPVGKERDFKKENKKIVADMMIAQNVPYVATA
TVAYPEDLIKKIEHAKAVHGPKFIQILAPCPTGWYYPPEKTIEISRLAVQSRMFPLYEFI
EGRFYLNKSFKPIDVSEYVKAQDRFKHLNEGEIENLRRYVEERWNQLLEWEKLYAGPVKA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccgacatcgataccaaaggaagagctcatggcgccagggcacacggcctgccatggt
tgcggtgcaacgctcgccatgagatatgtgctgaaagctcttggagagaagacggttgta
tctgttccagcttcttgctgggcggtcatcccgggggcaatgcccttcaggacgcttgat
gtgccgatggtttatacaccatttgcagccacaggtgcaagcatatccgggctcagggag
ggcctggatatacaggggaagagcgattacaacgtggtcgggtttgcaggagacggcggt
accgctgatatcggcctgcagggcctcagcggtgcaatggaacgcggccacaacgtcttc
tacataatgtacgataacgagggctatatgaacacaggcgtgcagaggtctggaagcacg
ccttacggtgcgagaacaactacaacgcccgttggaaaggagagggatttcaagaaggaa
aataagaagattgtcgcggacatgatgatagcgcagaatgtcccatatgttgcaacggca
accgtcgcctaccctgaggatctgataaagaagatcgagcatgcgaaagcagtccatggt
ccaaagttcatacagatactcgccccatgcccgactggatggtactacccacctgaaaag
accatagagatctccaggctggcggtccaatccaggatgttcccgctgtatgaattcata
gaaggtcgcttttacctgaacaagagcttcaagccaatcgacgtgtctgaatacgtcaag
gcccaggacagattcaagcatctgaatgaaggcgagatcgagaatctcaggagatacgtg
gaggagaggtggaatcagctcctggaatgggaaaaactatacgcaggcccagtcaaggcc
tga

DBGET integrated database retrieval system