KEGG   Trichoplax adhaerens: TRIADDRAFT_32175Help
Entry
TRIADDRAFT_32175  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tad  Trichoplax adhaerens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TRIADDRAFT_32175
   00052 Galactose metabolism
    TRIADDRAFT_32175
   00500 Starch and sucrose metabolism
    TRIADDRAFT_32175
   00520 Amino sugar and nucleotide sugar metabolism
    TRIADDRAFT_32175
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TRIADDRAFT_32175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 495 aa AA seqDB search
MWNVAEFQAQAKRDSEIAMQHDLDAMLQTAPADQKEASTIMGKELNGFSKLFSRYIENKG
SAIKWDKIRPLPEGAVRKYDDIKVRESEVSRALLDQLVVLKLNGGLGTSMGCTGPKSIIT
VHTNATFLDLTIQQIEFLNDKYNASVPLVLMNSFNTHEDTLKVLRKYKSARVDIHCFNQS
RYPRIYSDNLHPVASQFDDHHDCWYPPGHGDTYAAFSNSGLLEKFLAMGKRYVFISNIDN
LGAVVDMSILNYLASPTDGERCDFVMEVTDKTRSDVKGGTLISYEDKLRLLEIAQVPKDH
VDEFKSIKKFQIFNTNNIWIDMKAIHELYSSNALDMEIIVNNKTMDTTGAHVIQLETAIG
AAIKCFNGAHGINVPRSRFLPVKKTADLLLAMSNLYTLRCGTLEMNPARSFPTVPLIKLG
DEFKKVRDFLRRFEDIPDILELDHLTVSGDVTFGKNVSLKGTVIIIANFGERIDIPSGAV
LENKIVTGNLRILEH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgttgctgaatttcaagctcaagctaaacgtgattctgaaattgctatgcaa
catgacttggatgcaatgctacaaactgctcctgccgatcaaaaagaggcaagtactata
atgggcaaggaattgaatggtttcagcaagctattttcaaggtacattgaaaataaaggt
tccgcaatcaagtgggacaaaattcgaccattgccggaaggagcagtccgaaagtatgat
gatatcaaagtacgagaatccgaggtttccagagctctattagatcagctagtggtttta
aaactgaatggtggattaggaactagcatgggttgcactggacctaaaagtatcattact
gtccatactaatgcaacatttctggatcttaccattcaacagattgagttcttgaacgac
aagtacaatgcaagcgttccgttggtactcatgaattcgttcaatactcacgaagatacg
ctgaaagtactacgaaaatacaaatccgctcgggttgatattcattgcttcaatcagagc
cgatatcctcgcatttacagtgacaacctgcatcctgttgctagtcaatttgatgatcat
catgattgttggtacccacccggtcatggtgatacttatgctgctttctctaattctgga
ctgttggagaaatttttagccatgggcaaacgctatgttttcatttccaatattgataac
ctaggagcagttgttgatatgtctattttaaactacttagccagccctactgatggtgaa
cgatgtgactttgttatggaagttactgataaaactagatctgatgttaagggtggtacg
ctcatcagttatgaagataaattgcgtcttttggaaattgctcaagtccctaaagatcat
gtcgacgaattcaaatccatcaagaaattccagatttttaacactaataatatttggatt
gacatgaaagcaattcatgagttgtacagcagcaacgccctagacatggaaattattgtg
aataacaaaacaatggataccaccggtgcacatgtcatacagctggaaaccgctattgga
gcagccatcaaatgctttaatggcgcccatggcattaatgtaccgcgttcccgctttctg
ccagttaagaaaacggctgatcttttgctagccatgtcgaatctatatactctgaggtgc
ggtaccttggaaatgaatcctgctcgttcctttccaactgttcccctaattaaacttggc
gatgaattcaaaaaggtcagagatttcttgagacgttttgaagatattccagatattcta
gagctagatcatctcactgtatccggagatgtaacatttggaaaaaatgtatctcttaag
ggcacagttataataatagctaactttggcgagaggattgacattcctagtggcgctgtc
ttggaaaacaaaatcgtgactggaaatttgcgcattttagaacattag

DBGET integrated database retrieval system