KEGG   Thermoplasmatales archaeon BRNA1: TALC_00201Help
Entry
TALC_00201        CDS       T02532                                 

Definition
(RefSeq) putative thymidine phosphorylase/AMP phosphorylase (EC:2.4.2.4)
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
tar  Thermoplasmatales archaeon BRNA1
Brite
Enzymes [BR:tar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     TALC_00201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175001..176515
Genome map
AA seq 504 aa AA seqDB search
MKLRAVSTDALSGAAVACLDPSDAMEIGVKENERMHIVGPKSEVTVFTILSEKLIEPGTV
AVPSGIMKRIGASEGDILSVTFNPSPESVRSIRRKMDGLVLDPAEISAVVKDIYGGNLSG
IEVSAWLTALYINGMNIDEIAAFAVAMVDTGDRVKFDRSPVFDFHSMGGVPGNKITPIVV
SIVAAAGLMIPKTSSRAISSACGTSDFVELFCPVEVDAQQLSEIGENVGGAFVWGGSMNI
APVDDIVIKIEHPLGINPRAQMLASIISKKLAIGAQYLLVDIPTGSGTKVKTLDEARAYA
RDFMDLGDKLGIHIECAITYADQPIGSAVGPALEARECLRILEGYEHPASVIEKACECAG
IVLEMGGFSNGVAKAHEILSSGAALKKFKEIVAAQGGNPDQTSEDIPLGQFTADIAARQS
GYVHSIDNKEVVAIAKALGAPTDKGAGMLLLKKKGQRVEQGDVLFQLFADNKTKLDRAKD
LAERYNPVRIEGMLLKHVTAIQPR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcagagcagtatcgaccgacgcgctgtcgggtgcggcagtagcctgtctggat
ccgtcggacgccatggagatcggggtgaaggagaacgagaggatgcacatcgtcggcccg
aagtccgaggtcacggtgttcaccatcctgtctgagaaactaatcgagcccgggaccgtt
gccgtcccatcgggcatcatgaagaggatcggcgccagcgagggggacattctttccgtc
acgttcaaccccagtccggagtccgtgcgttccatccgccgcaagatggacgggctggta
ctggatcccgccgagatatccgcggtggtgaaggacatctacggaggcaatctttcgggc
atcgaggtctccgcatggctcaccgccctgtacatcaacgggatgaacatcgacgagatc
gccgccttcgccgtcgcgatggtcgacaccggcgacagggtcaagttcgaccgttccccg
gtgttcgacttccacagcatgggaggggtccccggaaacaagatcacgcccatcgtcgta
tccatcgtcgccgctgccggcctgatgatacccaagacgtcttccagggccatcagcagc
gcctgcggcacttccgatttcgtggagttgttctgtcccgtagaggtggatgcccagcag
ctctccgagatcggggagaacgtcggcggggcattcgtctggggaggcagcatgaacatc
gctcccgtggacgatatcgtgatcaagattgagcacccgctcggcatcaatccccgggcc
cagatgctcgccagcatcatcagcaagaaactggccatcggtgcgcagtacctcctggtg
gacattcccaccgggagcggtaccaaggtcaagaccctggacgaggcaagggcatacgcc
agggacttcatggatctgggagacaagctaggaatacacatcgagtgcgcgatcacctat
gcggaccagcccatcggcagtgccgtgggtcccgcactggaggccagggagtgcctgaga
atcctggaaggttacgagcatcccgcaagcgtcatcgagaaggcctgcgagtgcgcgggg
atcgtcctcgagatgggaggattcagcaatggcgtcgccaaggcgcacgagatcctctcg
tccggagccgccctcaagaagttcaaggagatcgtagcggctcagggaggcaaccccgac
cagacctccgaggacatccccctcggacagttcaccgccgacatcgccgcccgccagtcc
ggctacgtgcacagcatcgacaacaaggaggtcgtcgccatcgccaaggccctgggcgcc
cccacggacaagggcgccggaatgctccttctgaagaagaaggggcagagagtggagcag
ggcgacgtcctgttccagctgttcgcggacaacaagaccaagctcgaccgcgccaaggac
ctggcggagagatacaaccccgtccgcatcgaggggatgctcctcaagcacgtgacggcc
atccagccaaggtga

DBGET integrated database retrieval system