KEGG   Thermoplasmatales archaeon BRNA1: TALC_00201Help
Entry
TALC_00201        CDS       T02532                                 

Definition
putative thymidine phosphorylase/AMP phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tar00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175001..176515
Genome map
AA seq 504 aa AA seqDB search
MKLRAVSTDALSGAAVACLDPSDAMEIGVKENERMHIVGPKSEVTVFTILSEKLIEPGTV
AVPSGIMKRIGASEGDILSVTFNPSPESVRSIRRKMDGLVLDPAEISAVVKDIYGGNLSG
IEVSAWLTALYINGMNIDEIAAFAVAMVDTGDRVKFDRSPVFDFHSMGGVPGNKITPIVV
SIVAAAGLMIPKTSSRAISSACGTSDFVELFCPVEVDAQQLSEIGENVGGAFVWGGSMNI
APVDDIVIKIEHPLGINPRAQMLASIISKKLAIGAQYLLVDIPTGSGTKVKTLDEARAYA
RDFMDLGDKLGIHIECAITYADQPIGSAVGPALEARECLRILEGYEHPASVIEKACECAG
IVLEMGGFSNGVAKAHEILSSGAALKKFKEIVAAQGGNPDQTSEDIPLGQFTADIAARQS
GYVHSIDNKEVVAIAKALGAPTDKGAGMLLLKKKGQRVEQGDVLFQLFADNKTKLDRAKD
LAERYNPVRIEGMLLKHVTAIQPR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcagagcagtatcgaccgacgcgctgtcgggtgcggcagtagcctgtctggat
ccgtcggacgccatggagatcggggtgaaggagaacgagaggatgcacatcgtcggcccg
aagtccgaggtcacggtgttcaccatcctgtctgagaaactaatcgagcccgggaccgtt
gccgtcccatcgggcatcatgaagaggatcggcgccagcgagggggacattctttccgtc
acgttcaaccccagtccggagtccgtgcgttccatccgccgcaagatggacgggctggta
ctggatcccgccgagatatccgcggtggtgaaggacatctacggaggcaatctttcgggc
atcgaggtctccgcatggctcaccgccctgtacatcaacgggatgaacatcgacgagatc
gccgccttcgccgtcgcgatggtcgacaccggcgacagggtcaagttcgaccgttccccg
gtgttcgacttccacagcatgggaggggtccccggaaacaagatcacgcccatcgtcgta
tccatcgtcgccgctgccggcctgatgatacccaagacgtcttccagggccatcagcagc
gcctgcggcacttccgatttcgtggagttgttctgtcccgtagaggtggatgcccagcag
ctctccgagatcggggagaacgtcggcggggcattcgtctggggaggcagcatgaacatc
gctcccgtggacgatatcgtgatcaagattgagcacccgctcggcatcaatccccgggcc
cagatgctcgccagcatcatcagcaagaaactggccatcggtgcgcagtacctcctggtg
gacattcccaccgggagcggtaccaaggtcaagaccctggacgaggcaagggcatacgcc
agggacttcatggatctgggagacaagctaggaatacacatcgagtgcgcgatcacctat
gcggaccagcccatcggcagtgccgtgggtcccgcactggaggccagggagtgcctgaga
atcctggaaggttacgagcatcccgcaagcgtcatcgagaaggcctgcgagtgcgcgggg
atcgtcctcgagatgggaggattcagcaatggcgtcgccaaggcgcacgagatcctctcg
tccggagccgccctcaagaagttcaaggagatcgtagcggctcagggaggcaaccccgac
cagacctccgaggacatccccctcggacagttcaccgccgacatcgccgcccgccagtcc
ggctacgtgcacagcatcgacaacaaggaggtcgtcgccatcgccaaggccctgggcgcc
cccacggacaagggcgccggaatgctccttctgaagaagaaggggcagagagtggagcag
ggcgacgtcctgttccagctgttcgcggacaacaagaccaagctcgaccgcgccaaggac
ctggcggagagatacaaccccgtccgcatcgaggggatgctcctcaagcacgtgacggcc
atccagccaaggtga

DBGET integrated database retrieval system