KEGG   Thermoplasmatales archaeon BRNA1: TALC_00246Help
Entry
TALC_00246        CDS       T02532                                 

Definition
Ribulose-5-phosphate 4-epimerase-related epimerase and aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tar00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(215912..216526)
Genome map
AA seq 204 aa AA seqDB search
MMSEAFLRRRLVECCKLLYQRNLTVSAGGNMSVRLDDKHILITPSGANKGMLTDDDLVLM
DMKGKVISGGKPSIEHRFHLGLYQANPEVNAIVHCHPLYCLAVATKGEPLKSTLTPEGVL
LLDQVPTVRYETPGSEELVKAVLECSDAPAMLMAKHGAITQGRTLEEAFNRMEELEFQAH
LQIILGNSAEPLPLEEVEKLREMR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgaggccttcctcaggagaaggctcgtggagtgctgcaagctcctctaccag
aggaacctcaccgtctccgccggaggcaacatgagcgtccgcctggacgacaagcacatc
ctgatcaccccgtcgggggccaacaagggaatgctcaccgacgacgacctggtcctcatg
gacatgaagggcaaggtcatttccggagggaaaccaagcatcgagcacaggttccacctc
ggcctctatcaggccaatcccgaggtcaacgccatagtgcactgccaccccctctactgc
ctcgcggtcgccaccaagggcgagccgctcaagagcaccctcacccccgagggagtgctc
ctcctcgaccaggtcccgaccgtcaggtacgagaccccgggatccgaggagctcgtgaag
gccgttctcgaatgctccgacgcgcccgccatgctcatggcaaaacacggggccatcacc
cagggaaggacccttgaggaggccttcaaccgcatggaggagctggaattccaggcccat
ctgcagatcattctcggcaattccgccgagccccttcccctcgaggaagtggagaaactc
agggagatgaggtga

DBGET integrated database retrieval system