KEGG   Taylorella asinigenitalis MCE3: TASI_0737Help
Entry
TASI_0737         CDS       T01634                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tas  Taylorella asinigenitalis MCE3
Brite
Enzymes [BR:tas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TASI_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744492..745265
Genome map
AA seq 257 aa AA seqDB search
MIKKQIISTNSNTRLSSGSRNIGIKSPSPEVKLRFQKALELNSGLNSDIHRIRMVEALRE
FGITSDTRVLDAMVRVQRHVFMDPGTRSRAYVDEALPIGYGQTISKPSVVARMITLALQN
NRQNNVLEIGTGCGYQAAVLSCIYKSVHSIERITGLYNLALSNIKRISDLPSIDIVLGDG
MLGLTKAAPYDAIILAAAGLEVPKTLLTQLDIGGILVAPVGGANQKLVTFRRISNNNWIN
SEYESTRFVPLKSGIQV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaacagatcatttccacaaatagtaatactcgattatcttcagggtctagg
aatatagggattaaaagtccttctcctgaagttaaattaaggtttcaaaaagccttggaa
ctgaattcaggccttaattctgatattcacagaatcagaatggttgaggcgttgcgtgaa
ttcggaattacttcagataccagagttttggacgcaatggttagagttcaaagacatgtc
tttatggatcctggtacaagaagtagagcttatgtggacgaagcattgccaataggatat
gggcaaacaatctctaagccttcagtcgttgcacgtatgataactttggcacttcaaaat
aatcgccaaaataatgtgcttgaaattggtacggggtgcggatatcaagctgcagtttta
tcttgtatctataaatctgtgcattccattgagagaataactggtctttacaatttagct
ttaagcaatataaagcgaatatctgatttgccatcaattgatatagttttaggggatggt
atgttaggtttaactaaagcagccccctatgatgcgattattctagctgcagcaggtcta
gaagtaccaaaaacattattaacccaattagatattggagggatattagttgctccagta
ggtggggctaatcagaagttagtaacatttagaaggatttctaataacaattggattaac
tctgagtatgaatcaacaaggtttgtgccgttgaaatctggaatacaagtataa

DBGET integrated database retrieval system