KEGG   Trypanosoma brucei: Tb927.5.1700Help
Entry
Tb927.5.1700      CDS       T01013                                 

Definition
(RefSeq) replication Factor A 28 kDa subunit, putative
  KO
K10739  replication factor A2
Organism
tbr  Trypanosoma brucei
Pathway
tbr03030  DNA replication
tbr03420  Nucleotide excision repair
tbr03430  Mismatch repair
tbr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tb927.5.1700
   03420 Nucleotide excision repair
    Tb927.5.1700
   03430 Mismatch repair
    Tb927.5.1700
   03440 Homologous recombination
    Tb927.5.1700
DNA replication proteins [BR:tbr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Tb927.5.1700
DNA repair and recombination proteins [BR:tbr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Tb927.5.1700
   MMR (mismatch exicision repair)
     Tb927.5.1700
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Tb927.5.1700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon Stork_head Peptidase_C39
Motif
Other DBs
NCBI-GeneID: 3657277
NCBI-ProteinID: XP_844844
UniProt: Q57ZN9
Position
5
AA seq 255 aa AA seqDB search
MEGSGSNFFTGAAANSNAATQQRRVHPIRPVTIKQLLEAQRVGEGVTVIDGREVTQATVV
GRVVGYENDSDNRFSGGALTAKHHGYRITDGTGVVVVRQWMDADQQDDPLPLQCYVRAAG
TVKMWQNSPIVTGTVRLVSDCNELNYHFLDVILTHLRLTQGSRRPSSAAPAAVPNTASAV
GVQNMFPGGDGKVFTTDVVINTIRQKARGEEGLSMDEISAAALQYGFSGQDVRNAIRTLM
EEGKIYQTHDCKFGI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaagtggaagtaacttctttactggtgccgcggcgaactcaaatgccgccacg
cagcagcggcgggtgcacccgatccgccccgtcacaattaaacaactgctcgaggctcaa
cgtgtgggtgaaggtgtgacggttattgatggtcgtgaggtgacacaagcaactgttgtg
gggcgagtggtgggctacgaaaacgatagcgacaaccgcttcagtggcggtgccctcacg
gctaaacaccacggctaccgaattactgatggcactggtgttgttgtggtgcggcagtgg
atggatgccgaccagcaggatgatccgctgccattgcaatgttatgtgcgggcagccggt
acagtgaagatgtggcaaaactctcctattgttacgggcacggtgcggcttgtgtcagac
tgtaatgaactaaactatcactttcttgacgtgattctcacacatctacgactcacgcag
gggtcgcgacgtcccagctctgctgctcccgctgcagttcccaatacggcgagtgcagtc
ggtgttcagaacatgtttcctggtggtgatggaaaggtgttcacgactgatgttgtcatc
aacacaatcaggcagaaggcacggggggaggagggactttccatggatgaaatctctgcg
gctgcattgcaatatggtttcagtggtcaagacgtacgcaacgccatacgtacgttgatg
gaggagggaaagatttaccaaacacatgattgtaagtttggcatttaa

DBGET integrated database retrieval system