KEGG   Trypanosoma brucei: Tb927.5.1700Help
Entry
Tb927.5.1700      CDS       T01013                                 

Gene name
Tb05.1P6.900
Definition
replication Factor A 28 kDa subunit
Orthology
K10739  
replication factor A2
Organism
tbr  Trypanosoma brucei
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tb927.5.1700 (Tb05.1P6.900)
   03420 Nucleotide excision repair
    Tb927.5.1700 (Tb05.1P6.900)
   03430 Mismatch repair
    Tb927.5.1700 (Tb05.1P6.900)
   03440 Homologous recombination
    Tb927.5.1700 (Tb05.1P6.900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 255 aa AA seqDB search
MEGSGSNFFTGAAANSNAATQQRRVHPIRPVTIKQLLEAQRVGEGVTVIDGREVTQATVV
GRVVGYENDSDNRFSGGALTAKHHGYRITDGTGVVVVRQWMDADQQDDPLPLQCYVRAAG
TVKMWQNSPIVTGTVRLVSDCNELNYHFLDVILTHLRLTQGSRRPSSAAPAAVPNTASAV
GVQNMFPGGDGKVFTTDVVINTIRQKARGEEGLSMDEISAAALQYGFSGQDVRNAIRTLM
EEGKIYQTHDCKFGI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaagtggaagtaacttctttactggtgccgcggcgaactcaaatgccgccacg
cagcagcggcgggtgcacccgatccgccccgtcacaattaaacaactgctcgaggctcaa
cgtgtgggtgaaggtgtgacggttattgatggtcgtgaggtgacacaagcaactgttgtg
gggcgagtggtgggctacgaaaacgatagcgacaaccgcttcagtggcggtgccctcacg
gctaaacaccacggctaccgaattactgatggcactggtgttgttgtggtgcggcagtgg
atggatgccgaccagcaggatgatccgctgccattgcaatgttatgtgcgggcagccggt
acagtgaagatgtggcaaaactctcctattgttacgggcacggtgcggcttgtgtcagac
tgtaatgaactaaactatcactttcttgacgtgattctcacacatctacgactcacgcag
gggtcgcgacgtcccagctctgctgctcccgctgcagttcccaatacggcgagtgcagtc
ggtgttcagaacatgtttcctggtggtgatggaaaggtgttcacgactgatgttgtcatc
aacacaatcaggcagaaggcacggggggaggagggactttccatggatgaaatctctgcg
gctgcattgcaatatggtttcagtggtcaagacgtacgcaacgccatacgtacgttgatg
gaggagggaaagatttaccaaacacatgattgtaagtttggcatttaa

DBGET integrated database retrieval system