KEGG   Tribolium castaneum (red flour beetle): 655088Help
Entry
655088            CDS       T01046                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     655088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 405 aa AA seqDB search
MAKNNLNGDSDVSSNCEDDEMVLYKKLSLNVITFRTVRDKQDLEDPPRKGSSFKPDMAHQ
IFGETEMIFGYKKLAINLFYLHNSAKCYVEVQTGGKIHENADDIMKALNPWLPENYRTEK
SDFLADLDEEKPGLMFGDVIDTFSTDSENVYKVTVCDLKNPDFRQFHQRFETLIVWFIDG
ANFIDLEDPRWVIFYVYEEGPESHFTPVGFCTVYKFFLYPNLTRPRISQFFVLPTHQKRG
IGTNLYKAVYNYLKQMPDSGDITVEEPTEVFQKIRDFCDSLHIYEDLEGKGINITTQNLK
QINEFLKKHKIGKRQAQRVFDILECLTAHKNGYKEYVKFTEGIRSRIANEIEKETRGSKR
LCNLERAGIVTEPIDKKAAIDAEYNKYVDSLEWPVNRLRALLVKK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaacaaccttaacggagacagtgatgtttcctcgaactgcgaagacgacgaa
atggtcttgtacaagaagctgagcctcaacgtgatcacgttccggaccgtgcgagacaag
caggatctggaggaccccccgaggaagggcagctcgtttaagcccgacatggcccaccag
atattcggggagacagagatgatttttgggtacaaaaaactggccataaatttgttttat
ttgcacaattcggccaagtgttacgttgaggtgcaaaccggggggaaaatacacgaaaac
gccgatgatatcatgaaagcgctaaatccctggctgccggaaaactaccggactgaaaag
agcgattttctcgccgatttggacgaggaaaagcccggtctgatgttcggggacgtgatc
gacacgttttccaccgattctgaaaatgtgtataaagtgacagtttgcgacttgaaaaac
cccgacttccgccagttccaccaacgtttcgagacgctaatcgtgtggttcatcgacggc
gccaacttcatagacctggaggacccccgctgggtgatcttctacgtctatgaagagggc
cccgagtcgcacttcaccccagtcggtttttgcaccgtttacaaatttttcctctacccc
aacttaacgcgcccccgaattagccaatttttcgtgctccccacgcaccagaagcgcgga
atcggcacgaatttgtacaaagctgtttacaattacttgaaacaaatgcccgactcgggc
gatattacagtggaagaaccgaccgaggtgttccagaaaatacgcgatttttgcgacagc
ttgcacatttatgaggatttggaggggaaagggatcaacatcacgacgcaaaatctgaag
caaattaacgagtttttgaagaaacacaagattgggaaacggcaagcgcagcgcgttttt
gatattttagaatgtctgactgcgcataaaaacgggtataaggagtacgtcaagttcacg
gaggggattcggagcaggattgccaacgagattgagaaggagactcggggcagtaagaga
ttgtgtaacttggagcgggccggaattgtgaccgaacctatcgacaaaaaggcagctatt
gatgcagagtataataaatatgtggatagtttggagtggcctgtgaatcggttgagggca
ctgttggtcaagaagtga

DBGET integrated database retrieval system