KEGG   Tribolium castaneum (red flour beetle): 659690Help
Entry
659690            CDS       T01046                                 

Definition
Cytochrome c proximal CG17903-PA-like
Orthology
K08738  
cytochrome c
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    659690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKTGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNKDTLFEYLENPKKYIPGTKMVFAGLKKPQERADLIAYLEQATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaccggctggtgatgtcgaaaagggcaagaaactcttcgtccaaaggtgcgcg
cagtgccacactgtcgaggccggaggcaaacacaagaccggccccaatttgcacggattg
atcggacggaaaacggggcaagccgccggttttgcttacaccgacgccaataaagccaaa
ggaatcacatggaacaaagacacgctgtttgagtacctcgaaaaccccaagaaatacatc
cccggaacaaaaatggtcttcgctggtctgaagaagccgcaagaacgggcggatcttatc
gcttacttggaacaagcaaccaaataa

DBGET integrated database retrieval system