KEGG   Tribolium castaneum (red flour beetle): 662602Help
Entry
662602            CDS       T01046                                 

Definition
similar to 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase classes I and II (Phosphoinositide phospholipase C)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tca00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tca04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tca04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:tca04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 1204 aa AA seqDB search
MSATPGGRTGAAATPSNAVSLKSIEVPQALQNGEKFIKWDEDSGVGTPVTLRVDKYGFYL
HWVDQNHEMDLLDIATIRDTRTGRYAKIPKDPKLRQIVTMGSQDTLEEKTVTVCCANDFV
NMNFINFCCTRKEIARLWTDALMSLAYNLNQINGTANLYLLKAYTKLILVTDKTGKIPIK
NIIKMFAQSRDDKRRIETVLQSTGLPYGKNDTLSPEKFQFEDFFNFYKNLTQRSEIEKVF
NDIVGSKKHMTAAQFVDFLNKTQRDPRLNEILHPYANTARAKDIIAQYEPNKYNAQKGQL
SFDGFLRYLMSEDNNIIAPSKYELCDEMDHPLAHYFINSSHNTYLTGHQLTGKSSTEMYR
QCLLAGCRCVELDFWNGREEPIIVHGYTFVPEISAREVLEAIAESAFKTSDFPVVLSFEN
HCNPRQQAKIANYCREIFGEMLLEAPLEAYKLEPGQPLPPPSVLKRKIIIKNKKKHHHHH
HHHHHHKKSTSAQPEAPPSEPTGNGDVPHHAPPLQANCRQGSKDSTGTEDEESSSDEDGE
TLETDNSTEPTNEGSDHKAATAGETEAGAEISALVNYVQPVHFTSFENAKKKNRSYEMSS
FDEKQATSLLKEYPVQFVNYNKHQLSRVYPAGTRFDSSNFMPQVFWNAGCQLVALNFQTL
DLAMQLNLGIFEYNFRCGYLLKPEFMRRTDRRFYPFAESTVDGIIAGTVKITVISGQFLT
DKRVGTYVEVEMYGLPADTVRKRFRTKTVPNNGINPVYDEEPFVFKKVVLPDLASIRIAA
YEESGRFIGHRVLPVVGLCPGYRHVNLRTEIGQPLPLATLFLHIVVKDYVPDGLSDFAEA
LANPIKYQSDLEKRAQQLAVLTDDMEPAEGTEDQKKNSLTKEQATNGSPIQRPLIATGAA
SVDATSDNEGPVIATSVDTKNPQHDSNSLPKNIEVKEEKFEELIAEPLDKILDNKLVKEK
KLELDKKLENLRKKHEKKKMTLQSQKSGDFSEKRSRLINMKLVKRLSSKNIVSGVFSTES
PSVEPLTCVADGPETSSGDPDKPSLPRSHSERLLSVNRDFVCQEKELREKYHEVIYNTAE
KVMKISQNNQLKTLKDQFERETTDLMRKLQADHREEVKALAKKHRNREQFTRVKREAESA
VVGRGVSEREKLGQIFESRREELQRQHEAVKDALAECRNKAKVALLKEFETRMARVESES
GGVL
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgactccgggaggcaggaccggagcggcggccaccccttccaacgctgtctcc
ctcaaatctatcgaggtgccccaggccctgcagaacggtgaaaaattcatcaaatgggat
gaggactctggggtgggaacccccgtcaccctgcgcgtggacaaatacggtttctacctc
cactgggtggaccaaaaccacgaaatggaccttctggacatagccaccatcagagatacg
cggacaggtcgctatgcaaaaatcccaaaggaccccaaattaagacagatcgtgacaatg
ggctctcaagacacgctcgaagagaagacagtgactgtttgttgtgccaatgactttgtg
aatatgaattttataaatttctgttgtacgaggaaagaaattgcaagattatggacggac
gcattgatgagtcttgcgtacaatcttaaccaaatcaatggcacggctaatttgtacctt
ttgaaggcttacacgaaattgattttggtcaccgacaagacggggaaaatccctattaaa
aacataataaaaatgtttgctcaaagcagagacgacaagagacggattgagaccgttttg
caatcaacggggctcccctatggcaagaatgacacgctaagtcccgaaaaattccaattt
gaagacttttttaatttttacaaaaacttgacccaacgcagcgagatagagaaggttttt
aacgacattgttggttcaaaaaagcacatgacggccgcacaattcgtcgattttttgaac
aaaacgcaacgagatccgcgcctgaacgaaattctacatccttacgcaaacacagcacgc
gccaaagacatcatcgcacaatacgagcccaacaaatacaatgcacaaaaaggccagtta
tccttcgacggttttctccgctacctcatgtcggaagataacaatataatagcaccgagt
aaatacgaactttgcgacgaaatggatcatcccctcgcccactatttcattaattcgtcg
cacaatacttatttaactggacaccaactaacgggcaaatccagcacagagatgtacaga
cagtgtttattggctggatgtcgttgcgtcgagttggatttttggaatgggagagaggaa
ccgatcattgtgcacggttatacgtttgttcctgaaatttcagcaagggaagtgcttgaa
gcgattgctgaaagtgcattcaaaacgtccgattttccggtggttttgtcgtttgaaaat
cactgtaatccgagacaacaggcgaaaatcgccaattattgtcgcgagattttcggagaa
atgctgctagaggcacctctagaggcgtacaagttggagccaggccagcctttgcctcca
ccatcagtcctgaagcgcaagataataataaagaataaaaaaaaacatcaccaccaccac
caccatcatcaccaccataaaaaaagcacatcggcccaaccggaagcaccaccatcggaa
cccaccggaaacggtgacgttccacaccacgcccctccattgcaggccaattgcagacaa
ggttctaaagactcaactgggacagaagatgaagaatcgtcaagtgacgaagacggcgaa
acactcgaaacggacaattcgacggaaccgacgaatgaaggaagcgatcacaaagcggca
acagctggagagaccgaggcaggagccgagatatcggctctagtgaattacgtacaaccg
gtgcatttcaccagcttcgaaaatgcgaaaaaaaaaaaccgcagttatgaaatgtcgtca
tttgatgaaaagcaggcaacttcacttttgaaagaatatcccgttcagttcgtcaactac
aacaaacatcaactgagccgcgtttacccggctggcactcgtttcgactcatcaaacttc
atgcctcaggttttttggaatgccggctgtcagctcgttgctttaaatttccaaacactt
gatttagccatgcaattaaatttgggcatttttgagtataattttcgttgtggttatttg
ctcaagcctgaatttatgcgacgaactgatcggcggttttatcctttcgctgaatcaaca
gtcgatggtataatcgcaggaacggtcaaaataactgtgatatctggacaatttttgact
gataagagagtagggacttatgtcgaagtggaaatgtatggcctaccagccgacacagta
cggaaacgcttccggacgaaaactgtgcccaataatggaattaatccagtctatgatgag
gaacctttcgtttttaaaaaagtcgttctgcctgatttggcttcgattcgaatcgcggcg
tatgaagaatctgggcgttttattggacatcgagttcttccagttgttggactgtgtcct
ggttatcgacacgtaaatttacgaactgaaatcggacaaccgttacctctggccacgtta
tttcttcatattgtggtcaaggattatgtaccggacggcctttctgactttgcagaggct
ttagccaacccgatcaagtatcaaagtgatttggaaaaacgcgcacaacagttagctgtt
ctcactgatgacatggaaccggccgaagggaccgaagaccagaaaaaaaatagcttgacc
aaagaacaagccaccaacggaagtccaatccaacggcccttgatagcaacaggggcggct
tcagtggacgccacctccgataacgaaggccccgtaatagcgaccagtgttgacacaaaa
aatccacaacacgattccaactccttaccgaaaaatattgaagtcaaagaagaaaagttt
gaagaactgatagccgaaccattggacaagattcttgacaataaattagttaaggagaaa
aaattggaattggacaagaaattggagaatttaaggaaaaaacacgagaagaagaaaatg
acgttgcagtcgcagaaatcgggcgatttttccgagaagaggtcacgtttgattaacatg
aagctggtcaagcgattatccagtaaaaatatcgtgagcggcgtgttctcgacggagtcg
ccgagcgtggagcccctcacgtgcgtggcggacggcccggagaccagcagcggcgacccc
gacaagccgtcgctgccccgcagccactcggagcgtctcctgtccgttaaccgcgacttt
gtgtgtcaggaaaaggagctgcgcgaaaaataccacgaagtgatttacaacacggccgaa
aaagtgatgaaaatctcacaaaacaaccaactgaagacactcaaagaccagttcgagcgc
gaaaccaccgacttgatgcgaaagttacaagccgaccatcgagaagaagtcaaagctttg
gcgaaaaagcaccgaaatcgtgaacagttcacgagggttaaaagggaagcggagtctgct
gttgtgggccggggggtctcagagagggaaaagctggggcagatttttgagagtcggaga
gaggagttgcaaaggcagcatgaggcggttaaggacgctttggccgagtgccggaataag
gcgaaggtggcgctcctgaaggagttcgagacgcggatggctcgcgtggagtccgaaagc
ggtggagttctgtga

DBGET integrated database retrieval system