KEGG   Tribolium castaneum (red flour beetle): 663776Help
Entry
663776            CDS       T01046                                 

Definition
histone-lysine N-methyltransferase Suv4-20
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    663776
Enzymes [BR:tca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     663776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG4
AA seq 700 aa AA seqDB search
MVVDVPLRSFHHKMQPTGMSPRELSENDDWATSLVLDPHLGFTTHKMNLRYRPIKTSTAE
LKSIVEEFQKTQNYEKAYNSIAKGEWMPKIKSKIQQNKLKEHIYRYLRVFDKESGFVIEP
CYRYSLEGQKGAKISATKKWYKNDKIECLVGCIAELTEEEEKQLLHPGKNDFSVMYSCRK
NCAQLWLGPAAYINHDCRANCKFVATGRDTACVKVLRDIEAGEEITCFYGEDFFGDKNCY
CECETCERRGMGAFAKESDKKEENGYRLRETDNRINRTKQKITCNNNKEEQFGGNRGEEK
IVAPLSMKELRQKGLTKYDAELLIAQGCKFSDIGEFPRKNRLSVSSAGNDNNNKKSEVKK
SVINEEPQALVSSRTSRLQRRQARQANQELMQTATHNVSRSNLLDDLQSNASSCMSTCSD
QDPVCDATQQNKKFNDKHESGKGVPQITDRPPTPVQTNENGITLRSHKCLNVEKSESVMP
KLEPQVVCNQNGIKHLSKRGTARVKTRHSSHLTKLNNNITANNDKDVYEFEDEDSKTDSL
CLRRNRTKETNGDNVIKPEIDNEDSREKSDDNQNNWHEVKTEPVFVPETTQVEKTPEKCG
RLKLTLRMKRSPVLDEVIESGNSLSEDSFEPEYEVLRVEGVEYTPFSHRKKRHKSKDRKR
DRKLKQSEEVTHLPMKRLRLIFGNESHTIDIPSTSSNCHT
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggttgtggatgtacctttgaggagttttcatcacaaaatgcagcctactggcatgagt
cctcgtgaattatccgaaaacgatgactgggctacatccctggtgctagacccacatctc
ggattcaccacacataaaatgaaccttcggtacaggcccatcaaaaccagcacagctgaa
cttaaaagtattgtggaagagtttcaaaaaactcagaattacgagaaagcctacaacagt
attgccaagggagaatggatgcccaaaatcaagtccaaaatccagcagaacaaactcaag
gagcatatttatcgctatctaagggtattcgacaaagagtcgggtttcgtgatcgaacct
tgttatcgttactcgctcgagggtcaaaagggcgctaaaatctcagcgacgaaaaaatgg
tacaaaaacgacaaaatcgaatgtttggtcggttgcatcgccgaattgaccgaagaagag
gaaaagcagcttcttcatccgggaaaaaacgacttttccgtgatgtacagttgccgaaag
aattgtgcacaactctggttgggccctgctgcgtatatcaatcacgattgcagggcaaat
tgtaaattcgtggctactggtagagacacggcgtgtgttaaagttttgcgcgacattgaa
gcgggtgaagagattacgtgtttctacggtgaagatttcttcggtgataaaaattgctat
tgcgagtgcgaaacgtgtgaaagacgcggaatgggcgcttttgcgaaagaaagcgacaaa
aaggaggagaacggttacagattgcgcgaaaccgataaccgaattaaccggaccaagcag
aaaatcacgtgtaataataacaaagaggaacagtttggtggtaatcgcggcgaggagaaa
atcgtggcgccgttgagtatgaaagaattgagacagaaggggttgacgaagtacgatgct
gaacttttgatagcgcaggggtgcaagttttcggatattggggagtttccgaggaagaac
cggttaagtgtgtcgagtgcgggtaatgacaataataacaagaaatctgaagttaaaaaa
tctgtgataaatgaagaaccgcaagccttggttagttcgaggacttcgagacttcaaaga
agacaggcgagacaagcaaatcaggagcttatgcaaactgccactcataatgtgtcgaga
tccaatcttttagatgacttgcagagtaacgcgagtagttgtatgagcacttgtagcgat
caagatccagtttgtgatgccacacagcagaataagaagtttaatgacaaacacgagagc
ggaaaaggggtgccgcagattacagatcgccccccgactccggtgcaaacaaacgagaac
ggcatcacattgcgtagccacaaatgcctcaatgtcgaaaaatctgagagtgtaatgccg
aaattggaacctcaggtcgtctgtaaccaaaacggtattaaacacttatcaaaacgtggc
acagctcgcgtgaaaacccgtcattcatcgcatctcaccaagttgaataacaatatcact
gccaataacgataaagacgtatacgagttcgaggacgaagactcgaagacggactcctta
tgtctgcgaaggaacagaacgaaagaaacgaacggtgataatgtgataaaacccgaaatt
gataacgaggattcgagggaaaagtctgacgataatcagaacaattggcacgaggttaaa
accgaaccggttttcgtgccggagacgacccaagtggagaaaacaccggaaaagtgcgga
cggttgaaattgacgttgaggatgaaacggagcccggtcttggatgaagttatcgagtcc
gggaatagtctgagtgaagacagtttcgaaccggagtatgaagtgttgagagtggagggc
gtagagtatacacctttttcacaccggaaaaagagacataaatcgaaggacaggaaaagg
gataggaaattaaaacaaagtgaagaggtgacccatttaccaatgaagagattacggtta
atatttgggaatgagagtcacacgatcgatatcccgtccactagttcaaattgtcataca
tga

DBGET integrated database retrieval system