KEGG   Thiomicrospira crunogena: Tcr_0815Help
Entry
Tcr_0815          CDS       T00296                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tcx  Thiomicrospira crunogena
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tcr_0815
   01230 Biosynthesis of amino acids
    Tcr_0815
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_0815
   00051 Fructose and mannose metabolism
    Tcr_0815
   00562 Inositol phosphate metabolism
    Tcr_0815
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tcr_0815
Enzymes [BR:tcx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tcr_0815
Exosome [BR:tcx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tcr_0815
  Exosomal proteins of bladder cancer cells
   Tcr_0815
  Exosomal proteins of melanoma cells
   Tcr_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
888176..888937
Genome map
AA seq 253 aa AA seqDB search
MRQLFVAGNWKMHGDKASIKTLVTGLNAKADSVGDVLVAVCPPAIYLDYTKNCLMAGEIA
LGGQNMAIEPVQGAYTGETSASMLKDVGCQYVILGHSERRAIYGETDQDIAAKVKTALDS
GLTPILCVGETLEERESGQLESVISQQLDAVISEVGIDQFADVVIAYEPVWAIGTGKTAS
AQQAQDVHAFIRGQLAKLNPSVAEKVIIQYGGSVKPNNASELFSQPDIDGGLIGGASLNA
DDFIAICQAAGEQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagacagttatttgttgctggtaattggaaaatgcatggtgataaggcatccattaaa
acacttgtgactggtttgaatgcgaaagcagacagtgttggggatgtattggtagcggtg
tgtccgcctgcaatttatcttgattatacaaaaaactgtttaatggcgggtgaaattgca
ttaggtggtcaaaatatggcaattgagccagtgcaaggtgcttatacaggtgaaacatca
gcctctatgttaaaagatgttgggtgccagtacgttattttagggcattcagaacgtcga
gctatttacggtgaaacagatcaagacatcgcagccaaggtgaaaaccgcattagattca
ggattaacgcctattttatgtgtgggcgaaacgcttgaagagcgtgaatcaggtcaattg
gagtcggtcatttctcaacagttggatgcggtgatttccgaagttggtattgatcagttt
gcagatgttgtaattgcttatgaacccgtgtgggcaatcgggactggaaaaacagccagt
gcccagcaagcacaagatgttcatgcctttattcgtggacaacttgcgaagttaaatcct
tcggttgcagaaaaagtcattattcaatacggtggaagcgttaagccaaataacgcttct
gaattatttagtcagccagatatcgatggtgggttgattggtggtgcttcattaaatgca
gatgactttattgcaatatgtcaggctgcaggagaacaataa

DBGET integrated database retrieval system