KEGG   Torulaspora delbrueckii: TDEL_0A07180Help
Entry
TDEL_0A07180      CDS       T02236                                 

Gene name
TDEL0A07180
Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDEL_0A07180 (TDEL0A07180)
   01230 Biosynthesis of amino acids
    TDEL_0A07180 (TDEL0A07180)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDEL_0A07180 (TDEL0A07180)
   00030 Pentose phosphate pathway
    TDEL_0A07180 (TDEL0A07180)
   00051 Fructose and mannose metabolism
    TDEL_0A07180 (TDEL0A07180)
   00052 Galactose metabolism
    TDEL_0A07180 (TDEL0A07180)
  Energy metabolism
   00680 Methane metabolism
    TDEL_0A07180 (TDEL0A07180)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TDEL_0A07180 (TDEL0A07180)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TDEL_0A07180 (TDEL0A07180)
Protein phosphatases and associated proteins [BR:tdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TDEL_0A07180 (TDEL0A07180)
Messenger RNA biogenesis [BR:tdl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TDEL_0A07180 (TDEL0A07180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1250836..1253712)
Genome map
AA seq 958 aa AA seqDB search
MTVNIPLVNGTSYCTLTAHSQESFQKTIEFYVDFLQLEKRSLDNSSVLLFNGPVSLKIVL
DDDASKQKVADAQLEKLKANAGVKDWRASVHESLVFNTADIQVIKDYLVKKDLPRQAYPT
DLFPMQLYTLDPLGNAVGVTSTKNAVSTMPTRPPTADEKTTSSLVSKAPSYTDLRSAVKT
TDSYPSIPEGSTRPKKAIAVMTSGGDAPGMNANVRAIVRTAIFKGCRPFVVMEGYSGLVH
GGPEYIKEFTWEDVRGWSSMGGTNIGTARCMEFKEREGRLLGAQHLIEAGVDALIVCGGD
GSLTGADLFRSEWPSLVAELLETKKITKEQEVRYKHLNICGTVGSIDNDMSTTDATIGAY
SALDRICTAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYILIPEKPASSRE
WQDQMCDIVSKHRSRGKRTTIVIIAEGAIAADLTPISSADVHKVLVDRLGLDTRITTLGH
VQRGGTAVAYDRILATLQGVEAVNAVLDSTPDTPSPLIAINENKITRKPLVESVKLTKSV
ADAIHAKDFKKAMALRDTEFIEHLNNFMATNSADHNEPKLPVDKRLKIAIVNVGAPAGGI
NSAVYSMATYCMSQGHKPYAIYNGWSGLARHESVRSLDWKSMLGWQSRGGSEIGTNRVTP
EDADLGMIAYYFQKYQFDGLVIVGGFEAFVSLNQLERARDSYAAFRIPMVLIPATLSNNV
PGTEYSLGSDTALNALMEYCDVIKQSASSTRGRAFVVDVQGGNSGFLATCAALAVGAQAS
YVPEEGISLAQLSQDIETLADSFAKSDGRNRFGKLILKSTNASKALSAESLASVMTAEAE
GKFDAKPAIPGHVQQGGLPSPIDRTRATRLAIKAVDFIENQQDIIKEARADDGLFNPDDK
ELSATATVLGVKGSHVRFTPIRQLYDFETEVTKRMPKIIHWEAQRAIADHLVGRKRVE
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgacggttaatattcctttggttaatggtacatcgtattgtactttgaccgcacattcc
caggaatctttccaaaagactattgaattttatgttgattttttgcaattagagaaacgt
tctttggataatagttctgttctgttgttcaatggaccagtttctttgaagattgttcta
gatgatgatgctagtaagcaaaaggttgcagatgctcagcttgaaaaattgaaggccaat
gctggtgttaaggactggagagcttctgttcatgagtccttggtttttaacactgctgat
atccaagttattaaggactatttggttaagaaggatttgcctcgtcaggcttatcctaca
gaccttttcccaatgcaattgtacactttggatccattgggaaatgcagtcggtgttacc
tctactaagaacgctgttagcacaatgccaactcgtccaccaactgcggatgaaaaaacc
acatcttctttggtatcaaaggctccttcttacactgatttgaggagtgctgttaagaca
actgattcttacccatctattccagagggttctaccaggccaaagaaggctatcgctgtt
atgacttctggtggtgatgcaccaggtatgaatgccaatgttagagccattgttcgtact
gccatcttcaagggctgtcgtccatttgtcgttatggaaggttactcaggtctagttcat
ggtggcccagaatacatcaaagagtttacatgggaagatgtgcgtggttggtctagcatg
ggtggtactaacatcggtactgctcgttgtatggaattcaaagaacgtgaaggtagattg
ttgggtgctcaacatttgatcgaagctggcgtggatgctttgattgtttgtggtggtgat
ggatccttgactggtgcagacttgttcagatccgaatggccatctttggtcgctgaattg
ttggagaccaagaaaattactaaggaacaggaagttagatacaagcacttgaacatctgt
ggtaccgtgggttccatcgataacgatatgtctactactgatgctactatcggtgcttac
tcggccttagacagaatctgtacagctatcgattacgtcgaagccaccgctaattctcac
tccagagctttcgttgtcgaagttatgggtagaaactgtggttggttggcattgttggct
ggtattgctacctctgctgactacatcttgatcccagagaagccagcttcttctcgtgaa
tggcaagaccagatgtgtgacattgtctctaagcacagaagtagaggtaagagaaccacc
atcgtcatcattgctgaaggtgctattgctgctgatttgactccaatctcatctgctgat
gttcacaaggtcttggtcgacagattgggcttggacacaagaattacaactttgggtcat
gttcaaagaggtggtaccgctgttgcctacgaccgtatcttggctactttacaaggtgtt
gaagcagttaacgctgtcttggactccactcctgataccccatctccattaattgccatc
aacgaaaacaagatcactcgtaaacctctggttgaatctgtcaagttgactaaatcggtg
gctgatgctattcatgctaaggatttcaagaaggctatggctttgagagacaccgaattc
atcgagcatttgaacaatttcatggcaactaactccgctgatcacaacgaacctaagcta
ccagttgacaagagactaaagatcgccattgtcaatgttggtgcaccagcaggtggtatc
aactctgccgtttactccatggccacttactgtatgtcccaaggtcacaagccatacgct
atttataacggttggtccggtttggcaagacacgaaagtgttcgttcattggactggaaa
tccatgttgggatggcaaagtcgtggtggttccgaaatcggtaccaacagagtcactcca
gaagatgctgatcttggtatgattgcatactacttccagaaataccaattcgatggtttg
gttattgtcggtggttttgaagccttcgtttctctaaaccaactagaaagagcaagagac
agttacgctgctttcagaattccaatggtcttgattccagctactttgtccaataacgtt
ccaggtaccgaatactcgcttggtagtgacactgctttgaacgctttgatggaatactgt
gatgttatcaagcaatccgcttcgtccactagaggaagagcctttgtcgttgacgtccaa
ggtggtaactctggtttcttggctacttgtgcagctttggctgttggtgctcaagcatcc
tatgttccagaagaaggtatctctttggcacaactatcacaggatattgaaactctagcc
gactcattcgccaagtctgacggtagaaatagattcggtaagttgattctaaagagtaca
aacgcttctaaggctttgagtgctgaatccctggccagcgtcatgacagcagaggccgaa
ggaaaattcgatgccaagcctgccatcccaggtcacgtacaacaaggtggtctaccatct
ccaatcgacagaacaagagccaccagactggccatcaaagccgtcgatttcattgaaaac
caacaagatattatcaaggaagctcgtgccgacgacggtctcttcaacccagacgataag
gaactttctgcaacggcaaccgtcctgggtgtcaagggctctcacgtcagattcactcct
atcagacagctttacgattttgagactgaagtgacaaagagaatgcctaagatcatccac
tgggaagctcaaagagccatcgctgaccatttggtcggtagaaaaagggttgaatga

DBGET integrated database retrieval system