KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1487Help
Entry
TepRe1_1487       CDS       T01495                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00260  Glycine, serine and threonine metabolism
tep00750  Vitamin B6 metabolism
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01120  Microbial metabolism in diverse environments
tep01230  Biosynthesis of amino acids
Module
tep_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TepRe1_1487
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TepRe1_1487
Enzymes [BR:tep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TepRe1_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF5133
Motif
Other DBs
NCBI-ProteinID: AEE91633
UniProt: F4LVW5
Position
complement(1520577..1521638)
Genome map
AA seq 353 aa AA seqDB search
MRQKTGIINNYFSYLPVKDKKNIVTLCEGSTPLLRAKNLEEYLDTEVHIYLKYEGLNPTG
SFKDRGMTVAVSKAVEDDASAVICASTGNTSASAAAYAAKARLKCIVLIPNGAIAMGKLA
QAIAYGAKVIAVNGNFDDALKMVREISSKKPITLVNSINPYRIEGQKTAAFEICDELEEA
PDYLAIPVGNAGNITAYWKGFKEYYSLKKSKKLPKMMGFQAAGAAPIVENRVIENPETIA
TAIRIGNPASWKYAVEAAENSGGRIQKVTDDEILQAYKILAKKEGVFVEPASAASVAGII
KMCKDKVLKKGEKIVAVLTGHGLKDPDTAIQNGVKPTVIEARMELLEKEIYGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaaaaacaggaataattaataattatttttcatatcttcctgttaaagacaaa
aagaatatagttacactttgtgaaggtagtacacccttacttcgagcaaagaatctggaa
gagtacttggatacagaagtgcatatttatttaaaatacgagggtttgaatccaacagga
tcttttaaagacaggggaatgactgttgccgtttctaaggctgttgaagatgatgcaagt
gctgtcatatgtgcttctacaggcaatacgtctgcttctgcggctgcttatgcggcaaaa
gctcgcttgaaatgcattgtcttgattccaaatggtgctattgctatgggaaaattggct
caggcaattgcttatggagcaaaagtaattgctgtaaacggcaattttgatgatgcctta
aagatggtaagagaaatatcttccaagaagccaataactcttgttaattcaataaatcca
tacaggatcgaaggccaaaagactgctgcttttgaaatttgtgatgagcttgaagaggca
ccggattatcttgctattccggtgggaaatgcaggaaatataacggcttattggaagggg
tttaaggaatactactcacttaaaaaaagtaagaagttgcctaaaatgatgggtttccaa
gctgctggtgcagcaccaattgttgaaaatagagttatcgagaaccctgaaaccatcgct
acggctattcgaataggcaatcctgcaagctggaagtacgccgtagaagctgctgaaaat
tctggaggcaggatacaaaaagtaacagatgatgaaattttgcaagcatataaaattctg
gcaaaaaaagaaggtgtttttgttgagccggcttcggctgcttcggtagcaggcattata
aaaatgtgtaaggataaggtcttgaaaaaaggagagaagatcgtggcagtattaactggt
catggtttaaaagatcccgacacagctattcagaacggagtgaagccgactgttattgag
gcaagaatggagttgctagaaaaagaaatatatggggagtga

DBGET integrated database retrieval system