KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1487Help
Entry
TepRe1_1487       CDS       T01495                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TepRe1_1487
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TepRe1_1487
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TepRe1_1487
Enzymes [BR:tep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TepRe1_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1520577..1521638)
Genome map
AA seq 353 aa AA seqDB search
MRQKTGIINNYFSYLPVKDKKNIVTLCEGSTPLLRAKNLEEYLDTEVHIYLKYEGLNPTG
SFKDRGMTVAVSKAVEDDASAVICASTGNTSASAAAYAAKARLKCIVLIPNGAIAMGKLA
QAIAYGAKVIAVNGNFDDALKMVREISSKKPITLVNSINPYRIEGQKTAAFEICDELEEA
PDYLAIPVGNAGNITAYWKGFKEYYSLKKSKKLPKMMGFQAAGAAPIVENRVIENPETIA
TAIRIGNPASWKYAVEAAENSGGRIQKVTDDEILQAYKILAKKEGVFVEPASAASVAGII
KMCKDKVLKKGEKIVAVLTGHGLKDPDTAIQNGVKPTVIEARMELLEKEIYGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaaaaacaggaataattaataattatttttcatatcttcctgttaaagacaaa
aagaatatagttacactttgtgaaggtagtacacccttacttcgagcaaagaatctggaa
gagtacttggatacagaagtgcatatttatttaaaatacgagggtttgaatccaacagga
tcttttaaagacaggggaatgactgttgccgtttctaaggctgttgaagatgatgcaagt
gctgtcatatgtgcttctacaggcaatacgtctgcttctgcggctgcttatgcggcaaaa
gctcgcttgaaatgcattgtcttgattccaaatggtgctattgctatgggaaaattggct
caggcaattgcttatggagcaaaagtaattgctgtaaacggcaattttgatgatgcctta
aagatggtaagagaaatatcttccaagaagccaataactcttgttaattcaataaatcca
tacaggatcgaaggccaaaagactgctgcttttgaaatttgtgatgagcttgaagaggca
ccggattatcttgctattccggtgggaaatgcaggaaatataacggcttattggaagggg
tttaaggaatactactcacttaaaaaaagtaagaagttgcctaaaatgatgggtttccaa
gctgctggtgcagcaccaattgttgaaaatagagttatcgagaaccctgaaaccatcgct
acggctattcgaataggcaatcctgcaagctggaagtacgccgtagaagctgctgaaaat
tctggaggcaggatacaaaaagtaacagatgatgaaattttgcaagcatataaaattctg
gcaaaaaaagaaggtgtttttgttgagccggcttcggctgcttcggtagcaggcattata
aaaatgtgtaaggataaggtcttgaaaaaaggagagaagatcgtggcagtattaactggt
catggtttaaaagatcccgacacagctattcagaacggagtgaagccgactgttattgag
gcaagaatggagttgctagaaaaagaaatatatggggagtga

DBGET integrated database retrieval system