KEGG   Taylorella equigenitalis MCE9: TEQUI_0261Help
Entry
TEQUI_0261        CDS       T01390                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TEQUI_0261
   00052 Galactose metabolism
    TEQUI_0261
   00500 Starch and sucrose metabolism
    TEQUI_0261
   00520 Amino sugar and nucleotide sugar metabolism
    TEQUI_0261
Enzymes [BR:teq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TEQUI_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(283184..284044)
Genome map
AA seq 286 aa AA seqDB search
MSTSSKKVTKAVFPVFGFGTRFLPITKSLPKEMLPIIDKPLLHYAVKEAVDAGIRDLIFI
VGSNRQSIEDYFDRNLPLENKLESDGKLEELGQVRDIVPPNVNCIFIRQHSPIGLGHAVL
KAKPVIGEDSFAVVLVDDLFYSQPHEESALQTLINHYEQFECSVIGTHEVNPESIHNYGV
ISGTQNDDEEATVLDGIVEKPIAERAPSNQAVLGRYVLDSKIFSCIEQTVVGKNGEIQLT
DAIEKLIQSEKVHAIPIKIRHFDCGSKEGWYKANMFFGDKIYGFKL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatcgagtaagaaagtaactaaagctgtatttccagtttttggatttggaact
agatttttgccgataacgaaatcattgccaaaggaaatgctaccaattatcgataaacca
ctacttcattatgcggtgaaagaggctgtggatgcgggtattagggatttaatatttatc
gtaggcagtaacagacaaagtatagaagattattttgatagaaatttgcctctagaaaat
aaacttgaatcagatggaaagctcgaggaattaggtcaagttcgtgatattgtgcctccg
aatgttaattgcatttttataagacagcattctcccataggtcttgggcatgctgtactt
aaagcgaaacctgtaataggggaggattcgttcgcagtagttttagtagacgatttgttc
tattcgcaaccgcacgaggaatcggctttgcagacactaattaatcattatgagcaattc
gaatgctcagttattggtacacatgaggtaaacccagaatccattcataattatggagtt
atttctgggactcaaaatgatgatgaagaggctacagttttagatggaattgtagagaaa
ccaattgctgaacgagccccatcaaatcaagctgtattaggaagatatgtattggattca
aaaattttttcttgtattgagcaaacggtcgttggaaaaaatggagagattcagctcaca
gatgccatagaaaaacttatacagtcagaaaaagtacatgccattcctatcaaaatcagg
cattttgactgcggttctaaagaaggttggtataaggcgaatatgttttttggagataaa
atttatggctttaaactgtaa

DBGET integrated database retrieval system