KEGG   Taylorella equigenitalis MCE9: TEQUI_0261Help
Entry
TEQUI_0261        CDS       T01390                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00040  Pentose and glucuronate interconversions
teq00052  Galactose metabolism
teq00500  Starch and sucrose metabolism
teq00520  Amino sugar and nucleotide sugar metabolism
teq01100  Metabolic pathways
teq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TEQUI_0261
   00052 Galactose metabolism
    TEQUI_0261
   00500 Starch and sucrose metabolism
    TEQUI_0261
   00520 Amino sugar and nucleotide sugar metabolism
    TEQUI_0261
Enzymes [BR:teq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TEQUI_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADU91212
UniProt: E8UEB6
Position
complement(283184..284044)
Genome map
AA seq 286 aa AA seqDB search
MSTSSKKVTKAVFPVFGFGTRFLPITKSLPKEMLPIIDKPLLHYAVKEAVDAGIRDLIFI
VGSNRQSIEDYFDRNLPLENKLESDGKLEELGQVRDIVPPNVNCIFIRQHSPIGLGHAVL
KAKPVIGEDSFAVVLVDDLFYSQPHEESALQTLINHYEQFECSVIGTHEVNPESIHNYGV
ISGTQNDDEEATVLDGIVEKPIAERAPSNQAVLGRYVLDSKIFSCIEQTVVGKNGEIQLT
DAIEKLIQSEKVHAIPIKIRHFDCGSKEGWYKANMFFGDKIYGFKL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatcgagtaagaaagtaactaaagctgtatttccagtttttggatttggaact
agatttttgccgataacgaaatcattgccaaaggaaatgctaccaattatcgataaacca
ctacttcattatgcggtgaaagaggctgtggatgcgggtattagggatttaatatttatc
gtaggcagtaacagacaaagtatagaagattattttgatagaaatttgcctctagaaaat
aaacttgaatcagatggaaagctcgaggaattaggtcaagttcgtgatattgtgcctccg
aatgttaattgcatttttataagacagcattctcccataggtcttgggcatgctgtactt
aaagcgaaacctgtaataggggaggattcgttcgcagtagttttagtagacgatttgttc
tattcgcaaccgcacgaggaatcggctttgcagacactaattaatcattatgagcaattc
gaatgctcagttattggtacacatgaggtaaacccagaatccattcataattatggagtt
atttctgggactcaaaatgatgatgaagaggctacagttttagatggaattgtagagaaa
ccaattgctgaacgagccccatcaaatcaagctgtattaggaagatatgtattggattca
aaaattttttcttgtattgagcaaacggtcgttggaaaaaatggagagattcagctcaca
gatgccatagaaaaacttatacagtcagaaaaagtacatgccattcctatcaaaatcagg
cattttgactgcggttctaaagaaggttggtataaggcgaatatgttttttggagataaa
atttatggctttaaactgtaa

DBGET integrated database retrieval system