KEGG   Tetrahymena thermophila: TTHERM_00083420Help
Entry
TTHERM_00083420   CDS       T01020                                 

Definition
(RefSeq) lysozyme protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 460 aa AA seqDB search
MNKLLVASLTILLITSFARAQKGILGFTPQYSGYSQDKYLCMKNSQNEFKYQNLVEKQIW
GYDRYHKTGQNYADNVGLSTNSIYVPCININAAEFPYFSQENQLFTFLKYFQQNHDVFKG
DFLWVSIEQNQSKNCQWHNDFNINCSVLEEIMNQVRRSFVGVGNIGIMTSKQDWEALFGN
KCNKYSSYPLHYKNYDNKPNFSDWIQQKFGGWTKPSMKTYSKGKYECYMEAELTVIISCF
LILLVASSVYSQSRIAFYDLLDYEENMYQCLKFYKVSTQLVDGFKDNTTIFSPQVQGKID
RAQEQGISTDLLFDPCVNTVRQENFYTPEHQVTKFSENYKFLTGYENIWFNVIQKADRNC
FWSTDANLNCEILTKYISLLQAQTGKKIGIRSSSLDWSNIFGTTTNCANFGNLPLSYINY
NQKPNFQDWQDQQFGSWRGPMMKEFDTTELCGLTTTLSVY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattattagttgcaagtttaactatccttttaattacttcttttgcaagagct
taaaaaggaatcttgggatttactccataatactcaggatattcctaagataagtattta
tgcatgaaaaactcctaaaatgagttcaaatactaaaatcttgttgaaaaatagatctgg
ggttatgatcgctaccataaaacagggtaaaattatgctgataatgttggtttatctact
aattctatttatgttccctgcattaatatcaacgcagccgagttcccatattttagttaa
gaaaactaactcttcacattccttaaatacttccaacaaaatcatgatgttttcaaagga
gattttttgtgggtttctattgagtaaaattaatctaaaaattgctagtggcataatgac
tttaatattaattgttcagttcttgaagaaataatgaactaagttaggcgctcatttgtt
ggagttggcaacattggtataatgacaagcaagtaagattgggaagccctttttggaaat
aaatgtaacaagtacagtagttacccccttcactataaaaactacgacaataaacctaat
ttcagtgattggattcaataaaagtttggtggctggactaaaccatcaatgaaaacttac
tctaagggaaaatatgaatgctacatggaggccgagttgactgtaataatttcttgcttt
ttaatactattagttgcttcaagtgtctactcataaagtagaattgccttctatgattta
cttgactatgaagaaaatatgtattaatgcttaaagttctataaagtctctactcaactc
gttgatggatttaaagataacaccacaatattttctccctaagtttaaggtaagattgac
agagcataagaataagggatttctacagatttactttttgacccttgcgttaatactgtc
agataagagaatttttacactcctgagcatcaagtaactaaattctctgaaaactacaaa
tttcttacaggctacgaaaatatctggtttaatgtcatttaaaaagctgatagaaattgc
ttttggtcaactgatgccaacttaaattgtgaaattttgactaaatacatttcccttctc
caagcctaaacaggtaagaaaattggtattcgctcatcatctcttgactggtccaatatc
ttcggtactaccacaaactgtgctaatttcggcaaccttccactttcttacataaactat
aatcaaaaaccaaacttctaagactggtaagattaataattcggctcttggagaggtcct
atgatgaaagaatttgacactactgaattatgcggtctcactactactttatctgtctat
tga

DBGET integrated database retrieval system