KEGG   Tetrahymena thermophila: TTHERM_00105430Help
Entry
TTHERM_00105430   CDS       T01020                                 

Definition
Profilin family protein
Orthology
K05759  
profilin
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 152 aa AA seqDB search
MSGWDQYIQYLLADKKCESAYILGKDHANIWACSTGIAALPTYQINVEGKNFNVNEAELL
VKALKNNGVPTDPNVGLRIKNEKYYTVRFDADAGTWYLKKDQGGACIAVTKQALVIGTFK
NDIKMTNGQPQNPGAVNAACEKLAESLKSANY
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttgggatcaatatatctaatatcttttggctgataagaagtgcgaatctgcc
tacatcctcggtaaggatcatgctaacatttgggcttgctctactggtattgctgctctt
cctacttactaaatcaatgtcgaaggtaaaaacttcaatgttaacgaagctgagctcttg
gttaaggctttgaagaacaacggtgttcccactgatcctaatgttggtttaagaattaag
aatgaaaagtactacactgtcagattcgacgctgatgctggtacctggtatcttaagaag
gattaaggtggtgcttgcattgccgttaccaagtaagctttagttattggtactttcaaa
aacgacatcaaaatgactaacggtcaacctcaaaatcctggtgccgtcaacgctgcttgt
gaaaagctcgctgaatccttaaagtccgctaactactga

DBGET integrated database retrieval system