KEGG   Thermoanaerobacter sp. X514: Teth514_0376Help
Entry
Teth514_0376      CDS       T00648                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tex  Thermoanaerobacter sp. X514
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
383800..384840
Genome map
AA seq 346 aa AA seqDB search
MDYKDLLKKLSESYGVSGHERGIYDLLKKEFEPISDEVKEDNFGNLIFKKKGTKGKYKVM
LAAHLDEIGLMVKDIDEKGFIKFTTVGGVDQRTLPSQEVIVHGKKDLLGVIGSKPPHLLS
SEDMEKAIKIDDMYVDVGLPKKEVEELVKIGDIITIKRDFRELLNDYVSGKALDDRAGIV
VMAVCLDELKKLYHYHDVYAVVTLQEEVGVRGATTSAYNVEPDIAIAIDVTHGKARGVSL
EIELGKGPAIGKGPNIHPAVYKGLVEAAKNYNINYQVEPLPGPSGTDAWAIQVSREGVPT
GLVSIPLRYMHTSVETANMKDVISSGKLLAYYIANLPEELEGHLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggatttattaaaaaagcttagtgaaagctacggggtttctgggcatgag
agaggaatttatgacctcttaaaaaaagaatttgaaccaatttcagatgaagttaaagaa
gacaattttggcaatcttatttttaaaaagaagggcacaaaaggcaagtacaaggtgatg
ttagcagctcatttagatgaaataggccttatggtgaaagatattgatgagaaaggattt
ataaaatttacaacagtaggaggggttgatcagaggactcttccttcccaagaagttata
gttcacggtaaaaaggatttgttgggagttataggaagtaagccaccacatcttttgtct
tctgaggacatggaaaaagctataaaaatagatgatatgtatgtggatgttggacttcct
aaaaaagaagtagaggaattagtcaaaattggcgacattataacgataaaaagagacttc
agagagcttttaaatgattatgtttctggaaaggccttagatgatagagccgggattgtt
gtgatggcagtatgccttgatgaactgaaaaaattatatcattatcatgatgtatatgca
gtagttacacttcaggaagaagtaggagtaagaggagctacaacttccgcttataatgta
gagccagacattgcaattgctattgacgttacccatggaaaagcaagaggggttagtctg
gagatagagttaggtaaaggacctgcaattggaaaaggacctaatattcatccggcagta
tacaaaggacttgttgaggctgcaaagaattacaatataaactatcaagtagagccgctt
ccaggtccatcaggaacagacgcttgggcgatacaggtttcaagagagggcgtgccaaca
ggattagtatcaatacctctaaggtatatgcatacttcagtagaaactgcaaatatgaaa
gatgtaataagtagtggtaaactcttagcttattatatagccaatcttccagaggaattg
gagggacacttatgttattaa

DBGET integrated database retrieval system