KEGG   Thermoanaerobacter sp. X514: Teth514_2106Help
Entry
Teth514_2106      CDS       T00648                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tex00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2114609..2116120)
Genome map
AA seq 503 aa AA seqDB search
MCGLAGIIGTADKSKIQRMLEKIQHRGPDESGIFADENITLGHNRLTIIDLYHGRQPIKN
EDGRYWLIYNGEIYNYQLLRKELKNHTFSTDTDSEVIIHLYEELGKNCINYIDGMFALAI
YDSKKKTIFIARDPLGIKPLYYGKTKEGYFVFASEIKALQEVTDDINEFPNGYIYTSEKG
FEKYYSIPQDPMHFGEVDDIINGLRLRLEDSVRKRLIADVPVGVFLSGGLDSSLIAAIAA
KYKNPLHSFAVGVEGSNDLKNARVVADYVGTIHHEFIYTEEDIKKILPEVIYHLESCDPA
LVRSAVATYFVSKLASNYVKVILSGEGADELFSGYHYLKNYTNSWKLQSELKYITRNLHN
TNLQRVDRMTMAHSIEGRVPFLDVEVLRYAFKITPSFKINGREKIEKWILRKLAENYLPE
SIVWRRKEKFAIGTGTSEILNKIAESEISDAEYIKNRFLPNGFEIKSKEELYYFKILKRF
FNVDSFIKDMGRSRSLNDNQIYA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattggcaggaattataggaactgctgataagagcaaaatacaaaggatgctt
gaaaaaatacaacatcgtggcccggatgagtcaggtatttttgcagatgaaaatattaca
ttaggccataataggttgacgataattgacctttatcatggacgccaacctataaaaaac
gaagatggcaggtattggcttatttataatggagaaatttataattaccaactattgcgt
aaagagttaaaaaaccatactttttccacagatactgatagcgaagttataattcatttg
tatgaagaactaggtaaaaattgtattaactatattgatggaatgtttgctttagctatt
tatgactctaaaaaaaagaccatatttattgctcgcgatccgttaggaataaagccattg
tattatggtaaaacaaaagaaggttattttgtctttgcttcggagattaaagcacttcag
gaagtaactgatgatataaatgaatttcctaatggatatatttataccagtgaaaagggg
tttgaaaaatattattcaattccccaggacccgatgcattttggagaggttgatgacatt
attaatggattaaggcttagattagaggattcagtaagaaaaaggttgattgctgatgtg
cctgttggagtatttttaagtggcggattggatagcagccttatagcagcaatagcagca
aaatacaaaaatccccttcactcatttgcagtaggtgtcgaaggaagtaatgacttaaag
aatgcaagagttgttgctgattatgtaggtacgattcaccatgaatttatttatacagag
gaggacataaaaaaaattttacccgaagttatatatcatcttgaatcctgtgatccagcc
ttagtcagaagtgctgttgcaacatattttgtatcaaaacttgcaagcaattacgtaaag
gttattctttcaggagaaggtgctgatgaattgtttagcggataccattaccttaaaaat
tataccaattcttggaaattacaatccgaattaaaatatataactcgaaatttgcataat
acaaatcttcaaagagttgacagaatgacaatggcacattccattgagggacgtgtaccg
tttttagatgtagaagtgttacggtatgcatttaaaataacaccgtcatttaaaattaac
ggccgagaaaaaatcgaaaagtggatacttagaaaacttgcagaaaattatttaccagaa
tcaattgtatggagaagaaaagaaaaatttgcaataggaactggtacatctgaaatattg
aataagatagccgaatcagaaattagcgatgcagagtatataaaaaatagattcctacct
aatggttttgaaataaagtctaaagaagagttgtattattttaaaattttaaaaagattt
tttaatgttgattcttttataaaggacatgggaagaagtagaagcctcaatgacaaccaa
atatatgcataa

DBGET integrated database retrieval system