KEGG   Taeniopygia guttata (zebra finch): 100221958Help
Entry
100221958         CDS       T01082                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 245 aa AA seqDB search
MSQLPSSAVLALMGLLFARTMAWTSSGKTHAELVNNLYKKGIIKSQRVFDVLLATDRGHY
IKYFPYMDSPQSIGYKATISAPHMHAHALELLKDQLVEGAKALDVGSGSGYLTACFARMI
GPTGKAVGVEHIKELVHESIRNVQEDDPTLLSSGRVKLVVGDGRQGYPEEAPYDAIHVGA
AAATVPKELLKELKPGGRLIVPVGPEGANQVLMQYDKTSDGNIIETQLMGVIYVPLTDKE
KQWPR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctgccgtccagcgccgtgctggcactcatggggctgctcttcgccaggacc
atggcctggacatccagcgggaaaacgcacgcggagctggtcaacaacctctacaaaaaa
gggatcattaagtctcagcgagtcttcgatgtgctgttggctacggacagaggtcactac
atcaagtatttcccatacatggattctcctcaatccattggctacaaggctacgatcagc
gccccgcacatgcacgcccacgcgctggagctgctcaaggatcagctggtggaaggtgcc
aaggcgctggatgtgggatctgggagcggatacctcaccgcgtgcttcgccagaatgatt
ggcccgacgggaaaagctgtgggtgtggagcacatcaaggagctggtgcacgaatccatc
cgcaacgtccaagaagatgatccgacgctgctcagctccggccgtgtgaagcttgtggtt
ggagacggcaggcagggataccccgaggaggctccttacgatgccatccatgtgggagcg
gctgcagccaccgtccccaaggagctgctgaaggagctgaagccaggcgggcgactgatc
gtgcccgtggggcccgagggagcgaaccaggtgctgatgcagtacgacaagaccagcgac
gggaacatcatcgagacccagctcatgggcgtcatctacgtccctctcacagacaaggaa
aagcagtggcctcggtaa

DBGET integrated database retrieval system