KEGG   Taeniopygia guttata (zebra finch): 100226009Help
Entry
100226009         CDS       T01082                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100226009 (USP3)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100226009 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 640 aa AA seqDB search
MQEQMLKTPQVHSSTTQHGWTKWSGVLERVFLLAREKAGSASHWWLRRGGKHYSSGLWRR
ALASCLGGTQKRPARQARSQLARGQLARSLRQAQGGADFGGTEETQPWQRHAHVEGEAPS
PQHPAMAAETSARHHSCCSSDITEGSSTTDVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQIPMTNHKKTEKQEKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTSDRHRKRKLLENSTLNSKLLKVNGSNAALCATGLRNLGNTCFMNAILQSLSNI
QQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGNQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSVILQENSSLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRNKRTKNQESGP
MCTLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLVAVVVHHGSGVGSGHYTAYAAHEG
RWFHFNDSTVTLTDEETVGKAKAYILFYVERQAKPGAEKL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagcaaatgctgaagactccgcaagttcactcatcgaccacgcagcatgggtgg
accaaatggagtggggtgctggagcgagtgtttctgctggctcgagaaaaagctgggagt
gcctcgcactggtggttgagacggggtggcaaacactacagcagcgggctgtggcggcga
gcactggccagctgcctgggtggaacacagaagcggccggccaggcaggcgcggagccag
ttggcgaggggccagctggcgcggagcctgaggcaggcccagggtggtgcagattttggc
ggaacagaagaaacccagccatggcagcggcacgcccacgtggagggggaggccccctcc
ccgcagcacccagccatggcagcggagacgtctgcacggcaccatagttgctgcagcagc
gacatcaccgagggcagcagcaccaccgatgtgtgccggtcaaataaaagtccctgggtc
tgtctgacgtgttcgagtgtccattgtggaagatatgtgaatggccatgcaaaaaagcat
tatgaagatgcacagattcctatgaccaatcataagaaaacagaaaaacaggagaaagtt
cagcatactgtgtgtatggattgcagtagttacagtacatactgttatcgctgtgatgat
tttgtagtcaatgataccaagcttggcctggtacagaaggtcagagagcacctacagaac
ttggaaaattcagcctttacatcagaccgacacaggaaacgaaaactattggaaaactca
actctgaacagcaagttattgaaagtaaatggaagcaacgctgccctttgtgccacaggc
cttcggaacctggggaacacttgtttcatgaacgcaatccttcagtcactcagtaacatt
cagcagttttgctgttacttcaaagagttgcctgcagtggagctgaggaatgggaagacg
gcagggcgacgaacttaccacaccaggagccagggggataataatgtttcacttgtggaa
gaattcagaaagacactctgtgctttatggcaaggaaaccaaactgcatttagtccagag
tctttattttacgttgtttggaaaataatgccaaattttaggggataccagcaacaggat
gcccacgagttcatgcgttaccttttggaccatctacacctggaactccagggtggcttc
aatggtgtttcacgttcagtaatcttgcaagaaaattctagcctgtctgcaagcaacaaa
tgttgcataaatggagcgtctactgttgtcactgccattttcggaggcattcttcaaaat
gaagtcaattgcctaatatgtgggactgaatctagaaagtttgacccattcctagacctt
tcgctagatattccaagtcagttcagaaataaacgtactaaaaaccaagagagtggacca
atgtgcacgctacgagattgtcttcgcagttttacagacctggaagaacttgatgagaca
gagctttacatgtgtcacaaatgcaaaaaaaaacagaagtccaccaaaaaattctggatt
cagaaactaccaaaggtgctatgcttacacttgaaacgctttcactggacagcatatctg
agaaacaaggttgatacgtatgttgagtttcccttgcgaggcctagacatgaaatgctac
ttgttagagcctgaaaacagtggcccagagagctgcctgtatgacctcgtggctgtggtt
gtgcatcacggctcaggcgttggttctggccactacacagcgtatgcagcgcacgagggc
cgctggttccacttcaatgacagtaccgtaacactgaccgatgaggagactgtgggtaag
gccaaagcctacatcctcttctatgtggagcgccaagccaagcctggagcagagaaactt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system