KEGG   Taeniopygia guttata (zebra finch): 100226043Help
Entry
100226043         CDS       T01082                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100226043
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100226043
Transcription machinery [BR:tgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100226043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 476 aa AA seqDB search
MCGAHLNRLHSCLYCVFFGCFTKKHIHEHAKTKRHNLAIDLLYGGIYCFMCQDYIYDKDM
EQIAKEEQRKAWKLQAFTPTVVSHYQCTMTGIGEKYSTWEPTKRELELLRHNPKRRKITT
NCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCEMSTLFQ
EFYSGHRSPHIPYRLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANN
PNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSV
VNGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHL
KRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVV
NHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtgcccacctgaacagactccactcttgcctctactgtgtcttctttggctgt
tttacaaagaaacatattcacgagcacgcgaagacaaagcgacacaatttagccatagac
cttttgtatgggggtatatactgctttatgtgtcaagattacatatacgacaaagacatg
gaacaaattgccaaagaagaacaacgaaaagcttggaaattacaagccttcaccccaaca
gtggtttctcactaccagtgtacaatgacaggcattggagagaaatattcaacatgggag
ccgaccaagagagagttagaattgctacgacacaaccccaagcgaagaaaaataaccaca
aactgcaccataggtctacgagggctaatcaatcttgggaacacatgttttatgaactgt
attgtccaggcacttacccacactccactgctgcgagatttcttcctctccgacaggcac
aaatgtgaaatgcaaagccccagctcatgtctggtctgtgaaatgtctacactctttcag
gagttttactctgggcaccgatctcctcacattccatataggttattgcacctggtatgg
actcacgcacggcatttagcagggtacgagcaacaagatgcacacgagttcctcattgct
gcattagatgtgctacacagacactgcaaaggtgatgataatgggaagaaggccaacaac
cccaaccactgtaactgcatcatagaccaaatcttcacaggtggactgcagtcggatgtt
acctgtcaagtctgccatggtgtttccacgacgatagacccgttctgggacatcagtttg
gatctgccaggctcctccacccccttctggccgctgagtccgggcagcgatggcagcgtg
gtcaatggggaaagccacgtgtcgggcaccaccaccctcacagactgcttgagaaggttt
acaaggccagaacatctaggaagcagtgccaaaatcaaatgtagtggttgccatagctac
caagaatctaccaaacaactcactatgaagaagttacccattgtggcctgttttcatctc
aaacggtttgaacactcagccaaactgaggcggaagatcactacgtatgtctcgtttcca
ctggagctggacatgacacctttcatggcttccagtaaagagagcagaatgaacgggcag
taccagcagccgacggatagtctaaacaatgataataagtattccttgtttgcagtagtt
aatcaccagggaaccttggagagtgggcactataccagcttcatccggcagcacaaggac
cagtggttcaagtgtgatgatgccattatcaccaaggcaagcattaaggatgtgctagac
agtgaaggatatttgctgttctatcacaaacagttcctggagtatgaatag

DBGET integrated database retrieval system