KEGG   Taeniopygia guttata (zebra finch): 100230150Help
Entry
100230150         CDS       T01082                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100230150 (JOSD1)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C86
   100230150 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1A
AA seq 202 aa AA seqDB search
MSCVPWKGDKTKSELPEPSQLPPQHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNAIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKVPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQTWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggtgacaagaccaaatcggaattgccagagccatcccag
ctaccgccacagcacatttaccatgagaagcaacgtagggagctgtgtgccctccatgcc
ctcaacaatgtcttccaggacagcaacgccttcactagggaaaccctgcaggagattttc
cagaggctgtctcccaacaccatggtgaccccccacaagaagagcatgctggggaatggg
aactatgatgtgaacgtgatcatggcagcacttcagaccaaaggctatgaggcagtttgg
tgggataaacgcagggatgttaatgccattgccctgtctaatgtgatgggctttatcatg
aatctgccctccagcctttgctggggcccgttgaagctccccctcaagcgacagcactgg
atctgtgtccgggaggtgggaggcacctattacaacctcgactccaagctcaaggtgccc
gagtggattggaggtgaaagtgagctcaggaaatttttgaaacaccagctgagaggaaag
aactgtgaactcctattggtggtgccagaggaagtggaagcacatcagacatggagagct
gacgtgtga

DBGET integrated database retrieval system