KEGG   Taeniopygia guttata (zebra finch): 100232167Help
Entry
100232167         CDS       T01082                                 

Gene name
ITGB8
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:tgu04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:tgu04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:tgu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 692 aa AA seqDB search
MAGTTQKGRCDTVFNLMKRGCQSDLVENPTVHVTIPSDHETNTQVTPGKVSVQLRPGSEA
NFMLKVRPLEKYPVDLYYLVDVSASMHNNIEKLNSVGFALSKKMENISLDFRLGFGSYVD
KTVSPYISIHPGRIHNQCSDYNLDCMPPHGYIHVLSLTDNIAEFRNAVNKQKISGNIDTP
EGGFDAMLQAAVCQSHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVIPHDGNCHLKDNV
YIKATSMEHPSLGQLSEKLIDNNINVIFAVQGSQFHWYKDLLPLLPGTVARQIESQAANL
NDLVVEAYQKLISEVKIQVDNQIQGLHFNITAICPDGSKKTGMEGCKNVGYNKEVLFNVS
VTMKGCHTTGGTKYVILKPIGFNETAIVNVQQSCACQYGDSTGHRVWADETSDSKQSQCS
DNNCSSNRDTLPSEKCRQHQDQPMCSGQGNCIDGKCFCYKNKLGKVYGKYCEMDDFSCPY
HQGNLCSGNGECEGGKCKCFAGWEGDRCECSSQSAKHCLNSKGQICSGRGKCVCGKCECT
DPRSFGRFCEYCPTCNKACEENWNCVQCYHSNNASQVILDQCTTSCTYLLHYIDNTSDCF
SGRNYFRVFSIIFIVTFLIGLLVVLIIRQIILQGSSNKIKSSSDYRVSSTKKDKMFLPTV
CTRTVTYRRDKPEEINIDISKLRLNETFKCEF
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctggcacaacacagaagggacgctgtgacactgttttcaacttaatgaaaagaggc
tgccaatcagatttggttgaaaaccccacggttcatgtcacaatacctagtgaccatgaa
acaaatacacaagtgacaccaggaaaagtttcagtccagctgcgtccaggaagtgaagca
aattttatgttaaaagttcgtcctttagagaaataccctgtggatctttactacttagtt
gatgtctcagcctctatgcacaacaatatagaaaagttaaattctgttggatttgcttta
tctaaaaagatggagaatatttctcttgattttcgacttggatttggatcctatgtggat
aaaactgtgtcaccttatattagcattcatccaggtagaatccataaccagtgcagtgac
tacaatttagattgtatgcctcctcatggttatattcatgtgctatccctgactgacaat
atagcagaattcagaaatgcagtgaataaacaaaaaatttctgggaatattgatacacct
gaagggggtttcgatgcgatgctccaagcagctgtgtgccagagccatattgggtggcgt
aaagaagcaaagcggctgcttcttgtgatgacagatcaaacttcccatctagcccttgat
agtaaattagcaggaattgtaattccccatgatggaaactgtcacttgaaagataatgtg
tacatcaaagctacgagtatggagcatccatctcttgggcagctctctgaaaaattgatt
gacaataacatcaatgttatttttgctgttcaaggaagccagtttcattggtataaagat
ctgttacctctcttgcctggtactgttgcaagacaaatagaatcccaagcagcaaatctc
aatgatttggtggtagaagcctatcagaaactaatctctgaagtgaaaattcaagtggat
aaccagatccaaggtcttcatttcaatatcactgcaatctgtcctgatggaagtaaaaaa
actggcatggaaggatgtaaaaatgtgggatataataaagaagtacttttcaatgtatca
gttacaatgaaaggatgtcatacaactggaggaacaaaatatgtcatacttaagcctatc
ggtttcaatgaaactgccattgtcaacgttcagcaaagctgtgcctgccagtatggagac
agcacagggcacagagtgtgggctgatgaaacttctgacagcaaacagtctcagtgcagt
gacaataactgtagctccaacagagacacgcttccctcggagaagtgcaggcaacaccag
gaccaacccatgtgcagtggtcaaggaaattgcatagatggaaaatgtttctgctacaaa
aacaagctaggcaaggtgtatggcaagtactgtgaaatggatgatttttcctgcccgtat
caccagggaaacttgtgttctggtaatggtgaatgtgaaggtggtaaatgcaaatgcttt
gctggctgggaaggtgatcgttgtgagtgctcatcacaatcagcaaagcactgcctgaat
tcaaagggccaaatttgcagtggaagaggaaaatgtgtatgtggaaagtgtgagtgcaca
gatccaagaagctttggccgtttctgtgaatattgccctacttgtaacaaagcctgtgaa
gaaaactggaactgtgttcagtgctatcattctaacaatgcatctcaagtcatacttgac
cagtgcacaacctcatgcacttacctactgcattatattgataatacttcagattgtttc
tctggacgaaactactttagagtcttttccataatctttatagttacctttctgattggg
ttgcttgttgtccttatcatcaggcagataattctacaggggagtagcaataaaattaaa
tcttcatctgattacagagtatcttcaacaaagaaggataagatgtttttgcctacagtt
tgtacaagaacagtaacatacagacgtgacaaaccagaggaaataaatatcgacatcagc
aagttgcgattaaacgaaactttcaagtgtgaattctga

DBGET integrated database retrieval system