KEGG   Thermococcus sp. AM4: TAM4_437Help
Entry
TAM4_437          CDS       T01638                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00300  Lysine biosynthesis
tha01100  Metabolic pathways
tha01120  Microbial metabolism in diverse environments
tha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TAM4_437
Enzymes [BR:tha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TAM4_437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: EEB74492
UniProt: B7QZQ9
Position
2042007..2043269
Genome map
AA seq 420 aa AA seqDB search
MEFEGVLKEVESLRDEMVKTLVELIKIPAISPDYGYEGEYDKAQKLLEIIMDWPFDKVEV
YNAPDERAKNGVRPNVLAYYYGEKGEESERLWILTHIDVVPPGDLSKWTVTEPFKPLVKD
GKVYGRGSEDNGQSLVASLYAVKAMMNLGIRPKRTVILAFVSDEETGSKYGIGWLMKEHP
ELFREDDLVLVPDGGNEDGTFIEVAEKGILWFKLKVKGQQVHASMPDKGLNAHRVALDLA
YNLDKRLHEKYSERDELFDPPESTFEPTMGGNPADSPNIIPGEHEVVFDCRVLPRYSLDD
ILRDVEDVAKEVKERHRKELDGKVLPEIEVEVLQRGDPAPPTDPNSEIVKLLKEAIKELR
GKEARVGGIGGGTFAAFFRRKGIPAVVWATLDETAHQPNEYAKIDNMVEDAKVMAYLALR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgaaggggttctgaaggaagttgaaagcttaagggacgagatggtaaagacg
ctcgtcgagctgattaagattccggccataagccccgactacggctacgagggggagtac
gacaaggcgcagaagttgcttgagattatcatggactggcccttcgacaaggtcgaggtc
tataacgcgcccgatgagagggccaagaacggggtcaggccgaacgtattggcctattac
tacggcgagaaaggtgaggaaagcgagaggctctggattcttacgcacatcgacgtcgtt
ccgccgggggacctgagcaagtggaccgttacggagccattcaaaccgctcgtcaaggac
ggcaaggtctacggacgcggaagcgaggacaacgggcagagtttggttgcttcgctctac
gctgtgaaggccatgatgaacctcggaataaggccgaagagaaccgtcattttggccttc
gtcagcgacgaggaaaccgggagcaagtacggaatcgggtggctgatgaaggagcacccg
gagctattcagggaagacgacctcgttctcgtcccagacggcggaaacgaggacggaacg
ttcatagaggttgccgaaaagggaatcctgtggttcaagctcaaggtcaagggccagcag
gtgcacgcgagcatgccggacaagggcctgaatgcacaccgcgtcgcactcgatttggcc
tacaacctcgacaaaaggcttcacgagaagtacagcgagagggacgaactctttgacccg
ccggagagtaccttcgagccgacgatgggaggaaacccggccgacagccccaacataatt
cccggcgagcacgaggtcgttttcgactgcagggtcctgccgaggtacagccttgacgat
attctcagggacgtcgaggacgtcgcgaaggaagttaaggagaggcacaggaaggagctt
gacgggaaggttctccccgaaatcgaggtggaggttctccagaggggcgacccggcaccg
ccgacggacccgaacagtgagatagtgaagctcctgaaggaggcgataaaagaactccgc
ggaaaggaagcaagggttggtggcataggaggcggaaccttcgcggcgttcttcaggagg
aagggaattccagcggttgtctgggcgacgctcgacgaaactgcccaccagcccaacgag
tacgccaagattgacaacatggtcgaagatgccaaggtcatggcatacttagctctgcgc
tga

DBGET integrated database retrieval system