KEGG   Thermococcus sp. AM4: TAM4_437Help
Entry
TAM4_437          CDS       T01638                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tha  Thermococcus sp. AM4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TAM4_437
  Amino acid metabolism
   00300 Lysine biosynthesis
    TAM4_437
Enzymes [BR:tha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TAM4_437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2042007..2043269
Genome map
AA seq 420 aa AA seqDB search
MEFEGVLKEVESLRDEMVKTLVELIKIPAISPDYGYEGEYDKAQKLLEIIMDWPFDKVEV
YNAPDERAKNGVRPNVLAYYYGEKGEESERLWILTHIDVVPPGDLSKWTVTEPFKPLVKD
GKVYGRGSEDNGQSLVASLYAVKAMMNLGIRPKRTVILAFVSDEETGSKYGIGWLMKEHP
ELFREDDLVLVPDGGNEDGTFIEVAEKGILWFKLKVKGQQVHASMPDKGLNAHRVALDLA
YNLDKRLHEKYSERDELFDPPESTFEPTMGGNPADSPNIIPGEHEVVFDCRVLPRYSLDD
ILRDVEDVAKEVKERHRKELDGKVLPEIEVEVLQRGDPAPPTDPNSEIVKLLKEAIKELR
GKEARVGGIGGGTFAAFFRRKGIPAVVWATLDETAHQPNEYAKIDNMVEDAKVMAYLALR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgaaggggttctgaaggaagttgaaagcttaagggacgagatggtaaagacg
ctcgtcgagctgattaagattccggccataagccccgactacggctacgagggggagtac
gacaaggcgcagaagttgcttgagattatcatggactggcccttcgacaaggtcgaggtc
tataacgcgcccgatgagagggccaagaacggggtcaggccgaacgtattggcctattac
tacggcgagaaaggtgaggaaagcgagaggctctggattcttacgcacatcgacgtcgtt
ccgccgggggacctgagcaagtggaccgttacggagccattcaaaccgctcgtcaaggac
ggcaaggtctacggacgcggaagcgaggacaacgggcagagtttggttgcttcgctctac
gctgtgaaggccatgatgaacctcggaataaggccgaagagaaccgtcattttggccttc
gtcagcgacgaggaaaccgggagcaagtacggaatcgggtggctgatgaaggagcacccg
gagctattcagggaagacgacctcgttctcgtcccagacggcggaaacgaggacggaacg
ttcatagaggttgccgaaaagggaatcctgtggttcaagctcaaggtcaagggccagcag
gtgcacgcgagcatgccggacaagggcctgaatgcacaccgcgtcgcactcgatttggcc
tacaacctcgacaaaaggcttcacgagaagtacagcgagagggacgaactctttgacccg
ccggagagtaccttcgagccgacgatgggaggaaacccggccgacagccccaacataatt
cccggcgagcacgaggtcgttttcgactgcagggtcctgccgaggtacagccttgacgat
attctcagggacgtcgaggacgtcgcgaaggaagttaaggagaggcacaggaaggagctt
gacgggaaggttctccccgaaatcgaggtggaggttctccagaggggcgacccggcaccg
ccgacggacccgaacagtgagatagtgaagctcctgaaggaggcgataaaagaactccgc
ggaaaggaagcaagggttggtggcataggaggcggaaccttcgcggcgttcttcaggagg
aagggaattccagcggttgtctgggcgacgctcgacgaaactgcccaccagcccaacgag
tacgccaagattgacaacatggtcgaagatgccaaggtcatggcatacttagctctgcgc
tga

DBGET integrated database retrieval system