KEGG   Thermococcus sp. 4557: GQS_03385Help
Entry
GQS_03385         CDS       T01588                                 

Definition
(GenBank) deblocking aminopeptidase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
the  Thermococcus sp. 4557
Brite
Enzymes [BR:the01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     GQS_03385
Peptidases [BR:the01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   GQS_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
646955..647992
Genome map
AA seq 345 aa AA seqDB search
MVDIELLRKIVEAPGVSGYEFLGIRDVVFEALKDHVDEIYVDKLGNVIAHKKGNGPRIMI
AAHMDKIGVMVNHIDKEGYLHIVPVGGVDPRTLVAQRIRFFTEKGERYGVVGHIPPHLQK
PEDRKKAADWDTIVVDVGADSREEAEEMGFRVGTVGEFAPAFVQLNENRIATPYLDDRVC
LYAMIEAARRVENHEADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQVGDKG
KIVPKLGGGPVMDVGPNINPKVRAFADEVAEKYEIPLQVEASPRPTGTDANIMQINREGV
ATAVLSIPIRYMHSQVETADLRDIDKTIEFARRFLEELREMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtggacattgaactgctcaggaaaattgtggaggcgccgggcgtttccggctacgag
ttccttggaataagggacgtcgtttttgaggccctgaaggaccacgtggacgagatatac
gttgacaagctcggcaacgttatcgcccacaagaaggggaacgggccgagaataatgatc
gcggcccacatggacaagataggcgtcatggtcaaccacatagacaaggagggctacctc
cacatagtccccgttggaggcgttgaccccagaaccctcgtcgcccagaggataaggttc
ttcaccgagaagggcgagcgctacggcgtcgtcggccacataccaccgcacctccagaag
cccgaggacaggaagaaggccgcggactgggacaccatcgttgtggacgtcggcgctgac
agcagggaagaagccgaggagatgggcttccgcgtcggaaccgtcggtgagttcgctcca
gcgttcgtccagctcaacgagaacaggattgcgacgccatacctcgacgaccgcgtttgc
ctctacgccatgatagaggccgccagaagggttgagaaccacgaggcggacatctacttc
gttgcctccgtgcaggaggaggtcggcctccgcggtgctagggtcgcgagctacgcgatt
gatccggagataggcatagccatggacgtcacctttgccaagcaggtcggcgacaagggt
aaaatcgtgcccaagctcggcggcggcccggtcatggacgtaggtccgaacatcaacccc
aaggttcgcgcctttgccgatgaggttgcggagaagtacgagataccgctccaggtcgag
gccagcccgaggccgaccggaaccgacgccaacataatgcagatcaaccgcgagggcgtt
gcgacggccgttctcagcataccgatacgctacatgcacagccaggtcgagaccgccgac
ctgagggacatagacaagaccatcgagttcgccaggcgcttcctcgaggagcttcgcgag
atggatctcactccgtga

DBGET integrated database retrieval system