KEGG   Thermococcus sp. 4557: GQS_03385Help
Entry
GQS_03385         CDS       T01588                                 

Definition
deblocking aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
the  Thermococcus sp. 4557
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:the00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646955..647992
Genome map
AA seq 345 aa AA seqDB search
MVDIELLRKIVEAPGVSGYEFLGIRDVVFEALKDHVDEIYVDKLGNVIAHKKGNGPRIMI
AAHMDKIGVMVNHIDKEGYLHIVPVGGVDPRTLVAQRIRFFTEKGERYGVVGHIPPHLQK
PEDRKKAADWDTIVVDVGADSREEAEEMGFRVGTVGEFAPAFVQLNENRIATPYLDDRVC
LYAMIEAARRVENHEADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQVGDKG
KIVPKLGGGPVMDVGPNINPKVRAFADEVAEKYEIPLQVEASPRPTGTDANIMQINREGV
ATAVLSIPIRYMHSQVETADLRDIDKTIEFARRFLEELREMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtggacattgaactgctcaggaaaattgtggaggcgccgggcgtttccggctacgag
ttccttggaataagggacgtcgtttttgaggccctgaaggaccacgtggacgagatatac
gttgacaagctcggcaacgttatcgcccacaagaaggggaacgggccgagaataatgatc
gcggcccacatggacaagataggcgtcatggtcaaccacatagacaaggagggctacctc
cacatagtccccgttggaggcgttgaccccagaaccctcgtcgcccagaggataaggttc
ttcaccgagaagggcgagcgctacggcgtcgtcggccacataccaccgcacctccagaag
cccgaggacaggaagaaggccgcggactgggacaccatcgttgtggacgtcggcgctgac
agcagggaagaagccgaggagatgggcttccgcgtcggaaccgtcggtgagttcgctcca
gcgttcgtccagctcaacgagaacaggattgcgacgccatacctcgacgaccgcgtttgc
ctctacgccatgatagaggccgccagaagggttgagaaccacgaggcggacatctacttc
gttgcctccgtgcaggaggaggtcggcctccgcggtgctagggtcgcgagctacgcgatt
gatccggagataggcatagccatggacgtcacctttgccaagcaggtcggcgacaagggt
aaaatcgtgcccaagctcggcggcggcccggtcatggacgtaggtccgaacatcaacccc
aaggttcgcgcctttgccgatgaggttgcggagaagtacgagataccgctccaggtcgag
gccagcccgaggccgaccggaaccgacgccaacataatgcagatcaaccgcgagggcgtt
gcgacggccgttctcagcataccgatacgctacatgcacagccaggtcgagaccgccgac
ctgagggacatagacaagaccatcgagttcgccaggcgcttcctcgaggagcttcgcgag
atggatctcactccgtga

DBGET integrated database retrieval system