KEGG   Thermococcus sp. 4557: GQS_04585Help
Entry
GQS_04585         CDS       T01588                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GQS_04585
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GQS_04585
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GQS_04585
Enzymes [BR:the01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GQS_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(888944..890008)
Genome map
AA seq 354 aa AA seqDB search
MLVCSHCGKGYPETFRLTCDCGGTLLVKRNHTDFFGSLRPHIDMRRYLNLLPVNEDYIPP
ATPAITPVSTLPIGQVSGFFKLEYLQPSGSFKDRGTWVTVAKLREEGITEVVLDSSGNAA
LSFALYGLASGIRVHTFVSYDTLPGKLSLLQRLGAVIHFVDGDRMTVHGRAVEFAEKSGI
TYVSHWLNPYFLEGTKTAAFEVYEQLGVPDYVIAPAGSGTLFLGLWKGFSELKGMGEIEE
LPTFVAVQASGYESLCERSSVKSRLAEGIAIPEPPRLEEMKAVLDETGGTCVSVEDSEIE
RALEWLWGRGFIVEPTSATVLAALWKLQESGFIPSGSGVLLPLTGSGLKMVEGI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtctgttcacactgcggaaaggggtaccccgaaacgtttcgcctgacctgcgac
tgcggcggaaccctgctcgtgaagaggaaccacactgatttcttcggcagccttcggccc
cacattgatatgcggcgctacctcaatctccttccggtgaatgaggattacatccctcca
gcaacgcccgccataacccccgtgagcaccctcccaatcggccaagtcagcgggttcttc
aagcttgagtacctccagccgagcggttccttcaaggacaggggcacctgggtgactgtg
gcgaagctgagggaggaaggcatcaccgaggtagtccttgacagctccggaaacgctgcc
ctgagctttgccctctacggcctcgcttcgggaatcagggttcacacatttgtctcatac
gacacgctccccggaaagctctcgctcctccagcgccttggggcggtgattcatttcgtt
gacggcgacaggatgaccgttcacgggagggcggtggagttcgcggagaagagcgggatt
acctacgtctcccactggctcaacccgtacttccttgagggaacaaagacggccgccttt
gaggtttacgagcagctcggcgtccccgactacgttatcgctccggccggaagcggaacg
ctcttcctcggtctctggaagggattctcagaactcaaaggtatgggagagatagaggag
ctccctacctttgtcgccgtccaggcctcgggctacgagagcctctgcgagcgttcgtcg
gttaaaagccgccttgcggagggaatagcgatacccgaacccccacgactggaggagatg
aaggcagttcttgatgaaaccggagggacctgcgtaagcgtcgaggattctgaaatagag
cgggctttggaatggctctgggggaggggtttcatagtggagccgacctctgcaacggtt
ctcgcggccttgtggaagctccaggagagcggcttcatcccatctggctcaggggttctc
cttccgctcaccggctccgggctgaagatggtcgaaggtatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system