KEGG   Thiomonas arsenitoxydans: THI_0876Help
Entry
THI_0876          CDS       T02347                                 

Gene name
isoJ
Definition
Glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    THI_0876 (isoJ)
Enzymes [BR:thi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THI_0876 (isoJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(875947..876639)
Genome map
AA seq 230 aa AA seqDB search
MIDLYSWATPNGHKIHILLEELGLPYRVHGVNIGRGEQFAPDFLAISPNNKIPALIDSDG
PDGQPISVFESGAILLYLAEKTGRFLGTGPRARIATLEWLMWQMGSIGPMLGQAHHFRQY
APEKIDYAIARYTNEAHRLYGVLDRRLASQPYLAGDDYTIADIAVFPWCRSAANQGIDWA
EFAHAKRWFDTIAARPAVQRGVQVLTDVRPAEMDATAREQLFGSTQYQRR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctactcctgggccacccccaacggccacaaaatccacatcctgctcgaa
gaactcggcctgccctaccgggtgcacggcgtgaacatcggccgcggcgaacagttcgcg
cccgactttctcgccatcagcccgaacaacaagattcccgccctgatcgatagcgacggc
ccggatggtcagcccatcagcgtgttcgagtcgggcgccatcctcctctatctggccgag
aagaccggccgctttctgggcacagggccgcgggcgcgcatcgccacgctcgaatggttg
atgtggcagatgggcagcatcggccccatgctcggccaggcgcaccacttccgccagtac
gcccccgagaaaatcgactacgccatcgcccgctataccaacgaggcgcaccggctctat
ggcgtgctcgaccggcggctggcgtcgcagccctatctggccggtgacgactacaccatc
gccgacatcgccgtctttccgtggtgtcgcagcgccgccaatcagggcatagactgggcc
gagtttgcgcatgccaagcgctggttcgacaccatcgccgcgcggcccgcggtgcagcgc
ggggtgcaagtgctgaccgacgtgcgcccggccgagatggacgccaccgcgcgcgaacag
ttgttcggcagcacccaataccagcgccgctga

DBGET integrated database retrieval system