KEGG   Thiomonas sp. 3As: THI_0876Help
Entry
THI_0876          CDS       T02347                                 

Gene name
isoJ
Definition
Glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
thi  Thiomonas sp. 3As
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:thi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(875947..876639)
Genome map
AA seq 230 aa AA seqDB search
MIDLYSWATPNGHKIHILLEELGLPYRVHGVNIGRGEQFAPDFLAISPNNKIPALIDSDG
PDGQPISVFESGAILLYLAEKTGRFLGTGPRARIATLEWLMWQMGSIGPMLGQAHHFRQY
APEKIDYAIARYTNEAHRLYGVLDRRLASQPYLAGDDYTIADIAVFPWCRSAANQGIDWA
EFAHAKRWFDTIAARPAVQRGVQVLTDVRPAEMDATAREQLFGSTQYQRR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctactcctgggccacccccaacggccacaaaatccacatcctgctcgaa
gaactcggcctgccctaccgggtgcacggcgtgaacatcggccgcggcgaacagttcgcg
cccgactttctcgccatcagcccgaacaacaagattcccgccctgatcgatagcgacggc
ccggatggtcagcccatcagcgtgttcgagtcgggcgccatcctcctctatctggccgag
aagaccggccgctttctgggcacagggccgcgggcgcgcatcgccacgctcgaatggttg
atgtggcagatgggcagcatcggccccatgctcggccaggcgcaccacttccgccagtac
gcccccgagaaaatcgactacgccatcgcccgctataccaacgaggcgcaccggctctat
ggcgtgctcgaccggcggctggcgtcgcagccctatctggccggtgacgactacaccatc
gccgacatcgccgtctttccgtggtgtcgcagcgccgccaatcagggcatagactgggcc
gagtttgcgcatgccaagcgctggttcgacaccatcgccgcgcggcccgcggtgcagcgc
ggggtgcaagtgctgaccgacgtgcgcccggccgagatggacgccaccgcgcgcgaacag
ttgttcggcagcacccaataccagcgccgctga

DBGET integrated database retrieval system