KEGG   Thermincola potens JR: TherJR_0371Help
Entry
TherJR_0371       CDS       T01226                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tjr  Thermincola potens JR
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tjr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tjr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tjr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tjr00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:tjr00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:tjr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
383832..385553
Genome map
AA seq 573 aa AA seqDB search
MENVEVLAPSPGKHNMENYEETCKNFKWEDVEKVFSWSTTGKVNLAYEAVDRMVDEKGKG
DMVALYYCDSKIEEKYTFADMKAYSNKFANVLRKYGIGKGDRVFIFMPRSPKLYFSFLGI
VKVGAIAGPLFEAFMEAALKDRLSDSEAVAIVTTPELKGRILKDELPNLKHIFVVGANGD
LGEREIDWDAEMAQASDEAELEWVDRETPLFLLYTSGSTGKPKGIIHVHNDMLGYYTTGK
YVGDLQEGDMYWCTADPGWVTGVVYGMLAPWLNGCSTILRGGRFNADEWYQTLEKYKVTV
WYSAPTAFRLLMAEGEEKIKQYDLSSLRHIMSVGEPLNPEVIRWFMKTLNVRVHDTWFMT
ETGMQMICNYPCMEIKLGSMGKPVPGVEAAIVDDDGNVLPPLQMGNLAIKKGWPAQMRAV
WKNPEKFNEYFKHDPWYISGDSAYMDEDGYFFFQGRVDDVINTAGERVGPFEVESKLIEH
PAIAEAGVIGKPDPVRGEIIKAFIALNEGYEWTEELAKEVRDFVKKGLAAHAAPREFEVK
DKLPKTRSGKIMRRVLKAWELGLPVGDLSTMED
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgtggaagttttggcgccatcgccgggaaaacacaacatggagaactacgaa
gaaacctgtaagaactttaagtgggaagacgtagagaaggtattcagttggtctaccacc
ggtaaagttaatttggcgtacgaggctgtagacagaatggtagatgaaaaaggcaaaggt
gatatggttgccttatattattgcgacagtaaaatcgaagaaaaatacacctttgctgat
atgaaggcttactccaataaattcgccaatgtcttacggaagtatggtatcgggaaaggc
gacagagtatttatcttcatgccgcgcagcccgaaattgtacttcagcttcttgggtatc
gttaaggttggagctattgccggtccgttgttcgaagcattcatggaagctgcattaaaa
gaccggctgtctgacagtgaagctgttgccatagtaactactcccgaattaaaaggccgg
attttgaaagatgagctgcccaacttgaagcacattttcgttgtaggcgctaatggcgac
ctcggcgagcgggaaattgactgggatgctgaaatggcgcaggcatccgatgaagcagaa
ctagaatgggttgatcgtgaaaccccgttattcctcttgtatacttccggttccaccggc
aagcccaagggtattatccacgtacataatgacatgcttggatattacactacgggcaag
tatgtgggcgatctccaagaaggagatatgtactggtgtacagcagacccgggttgggta
acaggtgttgtttacggcatgcttgctccgtggcttaacggatgctctactatccttagg
ggcggacgtttcaatgctgatgaatggtatcaaaccctggaaaaatataaagtaactgtt
tggtacagtgctccgactgccttccggctgttaatggctgaaggtgaagaaaagattaag
caatacgacttgtccagtctgcgtcacattatgtctgtaggcgaaccgctgaacccggaa
gttatccgctggtttatgaaaaccttgaatgttcgtgtacacgatacttggttcatgact
gaaaccggtatgcaaatgatttgcaactatccctgcatggaaattaaacttggttccatg
ggtaaaccggttcccggtgttgaggcagctatcgtggatgacgacggcaatgttctgccg
ccgctgcagatgggtaacctggccattaagaaaggctggcccgcccagatgcgtgctgta
tggaagaatcctgaaaaatttaacgaatatttcaagcatgacccctggtatatttccggt
gactccgcatacatggatgaagacggctatttcttcttccagggacgtgttgatgatgtt
atcaacactgccggtgagcgggtaggtcctttcgaagtagagtccaaactcattgagcac
ccggctattgccgaagccggtgtaatcggtaaaccggaccccgttcgtggcgaaattatc
aaggcctttatcgcattaaacgaaggttatgaatggacggaggaattggctaaggaagta
agagactttgttaagaagggattagctgctcatgccgcaccgcgtgaattcgaagttaag
gataaactgccgaaaacacgttccggcaagattatgcgccgggtgctgaaggcttgggag
ttaggtctacctgtaggcgacctctccactatggaagactaa

DBGET integrated database retrieval system