KEGG   Tuber melanosporum: GSTUM_00000195001Help
Entry
GSTUM_00000195001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tml  Tuber melanosporum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GSTUM_00000195001
   00052 Galactose metabolism
    GSTUM_00000195001
   00500 Starch and sucrose metabolism
    GSTUM_00000195001
   00520 Amino sugar and nucleotide sugar metabolism
    GSTUM_00000195001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GSTUM_00000195001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 665 aa AA seqDB search
MASFTSRWCPVLCFRHPRQACNIPLTLRPPRRSASRSFRPSLSLLHSFLFSPFLTPISQQ
ANSSSSPALLNNSLCKKAIESTTFHPSSIPLPFLQQEVQERTFQALQQEPVDVKPVEAKP
IQTVQTVQTVQTATAIPTEQQQPEKMSSFKKSLPVEGGAPGEGLAPPGRRHGKSQSAFAF
DNTSTSVAASQMRNALNGLADSVKDPKTKVAFETEMDNFFALFRRYLQDKAKGTTLDWDR
IQPPQSSQVIPYDTLPRVEDPKLLSKLAVLKLNGGLGTSMGCVGPKSVIEVREGMSFLDL
SVRQVEYLNRTYNVDVPFVLMNSFNTDDDTQNIIKKYEGHRVTIHTFNQSRYPRVLKDSL
LPATKDYHSPIVDWYPPGHGDVFESLQNSGILDSLLEKDIEYLFLSNVDNLGAVVDLSIL
DHMRETGAEYIMELTDKTKADVKGGTIIDYEGTVRLLEIAQVPKEHEQDFKSIKKFKYFN
TNNIWLNLKAIKRVVENHELELEIIPNSKTIPVDKKGESDISVIQLETAVGAAIRHFKNA
HGVNVPRRRFLPVKTCSDLMLVKSDLYSMKHGQLMMDVARFGPAPLIKLGSHFKKVSDFQ
KRVPSIPRILELDHLTVTGAVNLGRGVTLKGTVIIVANEGSTIDIPPGSVLENVVVQGSL
RLLEH
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttcacctcgagatggtgccctgtgctgtgctttcgtcatcctagacaagct
tgtaatatccccctcaccctccgccctcctcgacgttctgccagccggtcttttagacct
tctctttccctacttcattccttcctcttctcccccttcctcactcctatctcccagcaa
gccaattcatcatcatcgccggctcttttgaacaatagcctctgcaagaaggccattgaa
tcaaccaccttccatccatcttctattccattgccgtttcttcaacaagaagtccaagaa
cgcacattccaagcactacagcaagagccggttgacgtcaagcctgttgaagccaagccc
atacaaacagtacaaacggtccagacggttcagacagccacagctataccaacagagcaa
cagcaacccgagaaaatgtcgtccttcaagaagagtttgccagttgaaggtggtgctcct
ggtgagggtctcgccccccccgggagaagacatggaaagtcccagtcagctttcgcattt
gacaacacctcaacctcagttgctgccagtcaaatgaggaatgctttgaacggccttgcc
gatagcgtcaaagatcccaagaccaaagtggcttttgagactgaaatggataacttcttt
gctttgttcagaagatatctgcaagataaggccaagggcactacattggattgggaccgc
atccagcccccccagtcttcccaggttattccctatgatacccttcccagggtcgaggac
cctaaactcctctcaaagcttgctgtcctcaagcttaatggtggtctcggaacttctatg
ggatgtgttggtcccaaatcggttattgaagtccgtgagggcatgtctttcctcgatttg
tccgtccgccaggttgaatatcttaaccgaacctacaacgttgatgtcccattcgtcctc
atgaactcgttcaacaccgacgatgatacccagaacatcatcaagaagtacgagggtcac
cgcgtaactattcacaccttcaaccaatcacgatacccccgcgtccttaaggactccctt
ctcccagccaccaaagattaccactcgcccattgttgactggtacccccccggacatggt
gatgtttttgagtcgctccagaactccggtatcttggacagtctgctcgagaaggacatc
gagtatctcttccttagtaatgtcgataacttgggtgctgttgttgacctgagtattctc
gatcacatgagggagacgggggcggaatacattatggagcttaccgacaagacaaaggcc
gacgtcaagggaggtaccatcattgactatgagggaaccgtccgacttcttgagattgcc
caagtccccaaagagcatgaacaggacttcaagtccatcaagaagttcaagtacttcaac
accaacaacatctggctcaacctcaaggctatcaaacgtgtcgtcgagaatcacgaactt
gaattggaaattatccccaactcgaaaaccatccccgtcgataagaagggcgaatccgac
atctcagtcattcagctcgagactgcagttggtgctgctattcgtcattttaagaatgct
catggggtcaacgttcctcgtaggagattcttgcctgtcaagacctgttctgacctcatg
ctggtcaagagtgacctctactccatgaaacatggtcaacttatgatggacgtcgcgaga
ttcggacctgcaccactgatcaagcttggaagtcactttaagaaggtttcagacttccag
aaacgtgttcctagtatccccagaattctggagttggaccatcttactgttaccggtgcg
gtcaatttgggtagaggtgttacgctaaaggggactgttattattgtcgcaaacgaaggt
tccaccattgatatcccccccggcagtgtcttggagaatgttgtcgtccagggttctttg
aggttgctcgaacattag

DBGET integrated database retrieval system