KEGG   Tuber melanosporum: GSTUM_00003444001Help
Entry
GSTUM_00003444001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tml  Tuber melanosporum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tml01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tml01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 465 aa AA seqDB search
MVPAASSPAGPAGAAAKLRKTRLVGPHISETPITFGNLWQHINKLNITLIVLVPLLGVWA
AFYTPLRTLTLCWAVLYYFWTGLGITAGYHRLWAHTSYSARLPLKIFLAALGGGAVEGSI
RWWSRDHRAHHRYTDTDKDPYSVRKGLLYSHVGWMILKQNPKRIGRTDISDLNEDPVVVW
QHKNYLAVVIFMGLVFPSFVSGLGWGDWVGGFVYAGILRIFFVQQATFCVNSLAHWLGDQ
PFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWTIWIWKQLGLAY
DLKQFRQNEIEKGRLQQQQKKLDRKRATLDWGVPLEQLPVMEFEDYQEQARNGRALVLVA
GVVHDISSFINDHPGGKAMINSGIGKDATAIFNGGVYNHSNAAHNLLSNFRVAVIRGGCE
VEIWKQASKENKDVDAALDSNNQRIVRAGNQVTRIAEPIAAAPAS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgctgcttcttctcctgctgggcctgccggggctgctgcaaagctccgaaag
acaagattagtcggtcctcacatcagtgaaacgccaattacttttggaaacctgtggcaa
catatcaacaaactcaacattaccctcatcgtcttggttcctctacttggtgtttgggca
gctttctacaccccccttcgaacacttaccctttgctgggccgtcctctattacttctgg
accggtctcggcatcaccgccgggtaccatcgtctttgggctcacacctcatattcagca
cgccttccgttgaagatcttccttgcagctcttggtggcggtgctgttgagggttctatt
cgttggtggtctcgtgatcaccgagctcatcaccgttataccgataccgacaaggatccc
tatagtgtccgcaagggattgttgtactcacatgtgggatggatgattcttaagcagaac
cctaagcgtattggacgtaccgacatttctgacttgaatgaggaccccgttgttgtctgg
caacacaagaactaccttgcggttgtcatcttcatgggtctcgtcttcccgtccttcgtt
tccggattgggttggggtgattgggttggtggattcgtctacgccggcatcctcaggatt
tttttcgtgcaacaggcaaccttctgcgtcaactctcttgctcattggctcggagaccaa
ccctttgacgatcgtaactctcctcgtgatcacgttatcaccgccttggtcactcttggc
gaaggataccacaacttccatcatgagttccctagcgactatcgtaatgctatcgaatgg
catcaatatgatcccaccaagtggaccatctggatctggaaacagctgggtctcgcctat
gacctcaagcagttccgtcaaaacgagatcgagaaaggccgtcttcaacagcaacagaag
aaactcgaccgtaagcgcgccactttggactggggtgttcctcttgagcagcttcctgtc
atggaatttgaggattaccaggagcaagcccggaatggacgcgctcttgtgcttgttgcc
ggtgttgttcacgatatttcttcattcatcaacgaccaccctggtggaaaggcaatgatc
aactccggaattgggaaggacgctactgctatattcaacggtggtgtctataaccactcc
aacgctgcccacaacctcctctccaacttccgcgtggctgtcattcgtggcggatgtgag
gtcgagatctggaagcaagcctcaaaggagaacaaggatgttgatgctgctctcgacagc
aacaaccagcgcatcgtccgagctggcaaccaagtcactcgaattgccgaaccaattgct
gctgctccggcatcatag

DBGET integrated database retrieval system