KEGG   Tistrella mobilis: TMO_1541Help
Entry
TMO_1541          CDS       T02128                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tmo  Tistrella mobilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1709744..1710409
Genome map
AA seq 221 aa AA seqDB search
METLAEAKIKLLMQLRSAGITDTRVLKAIETVPREIFVPTPLVPKAYANRALPIGQGQTI
SQPEVVALMTQALELGDRHKVLEIGTGSGYQTAILSRLARRVYTVERHRSLAREAQSRFG
ELAMHNVVNRIGDGMRGWPEQAPFDRIIVTAASDEVPEELLDQLAIGGLMVMPVGAHGRE
QRLMKLIRNEDGVDDVEIARVRFVPLMPGVPREDDPGSPAG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggagacgctcgccgaagcgaagatcaagctgttgatgcagctgcgttcggcgggcatc
accgacacgcgggtgctgaaggccatcgagacggtgccgcgcgagatcttcgtgccgaca
ccgctggtgcccaaggcctatgccaatcgcgccctgcccatcgggcagggccagaccatc
agtcagcccgaggtggtggcgctgatgacccaggccctggagctgggcgaccggcacaag
gtgctggagatcggtaccggctccggctaccagaccgcgatcctgtcgcggctggctcgc
cgggtctatacggtcgagcgtcatcgcagcctggcgcgggaagcccagagccgtttcggg
gaactggccatgcacaatgtggtcaaccggatcggcgatggtatgcgtggctggcccgaa
caggcgcctttcgaccggatcatcgtgacagctgcttcggacgaagtgcccgaagaactg
ctcgatcagctggcgatcggcggactgatggtgatgccggtgggcgcccatggccgcgaa
cagcgcctgatgaagctgatccgcaacgaagatggcgtcgacgacgtcgagattgcccgc
gtccgtttcgtgccgctgatgcccggcgtgccgcgcgaagatgatccgggctcgccggcg
ggttga

DBGET integrated database retrieval system