KEGG   Thauera sp. MZ1T: Tmz1t_1824Help
Entry
Tmz1t_1824        CDS       T00804                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00230  Purine metabolism
tmz00670  One carbon pool by folate
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01130  Biosynthesis of antibiotics
Module
tmz_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tmz1t_1824
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Tmz1t_1824
Enzymes [BR:tmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Tmz1t_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ACK54576
JGI: Tmz1t_1824
UniProt: C4ZKQ9
Position
2047166..2047822
Genome map
AA seq 218 aa AA seqDB search
MKSIVILISGRGSNMEAIVRAGIPGARIAAVISNRPGAGGLEFARAHGIATAVVDHKSHP
DRAGFDQALAECIDAHAPDLVVLAGFMRVLGDGFVRRYEGRLLNIHPSLLPAFPGLHTHR
RALETGVKVHGASVHFVTAELDDGPIVIQAAVPVLTGDDEDKLAARVLAQEHLIYPQAVR
WFVEDRLELVAGRVSLRDAPAQDGEALLVPAPEGGGRA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccatcgtcatcctcatttccggccgcggcagcaatatggaagccatcgtgcgt
gcgggcatcccgggcgcgcgtatcgccgcggtgatcagcaaccggccgggcgccggcggg
ctcgagttcgcacgcgcgcacggcatcgccaccgcggtcgtcgaccacaagtcccacccc
gaccgcgccggcttcgaccaggcgctcgccgagtgcatcgacgcccatgcgcccgacctg
gtcgtgctcgccgggttcatgcgcgtgctcggcgacggcttcgtgcgccgctacgaaggc
cgcctgctcaacatccacccctcgctgctgccggccttcccggggctgcacacccaccgc
cgcgcgctcgagaccggggtgaaggtgcatggcgcgagcgtgcatttcgtcaccgccgag
ctcgacgacgggccgatcgtgatccaggccgcggtgccggtgctgacgggcgacgacgag
gacaagctggccgcgcgcgtgctggcgcaggaacacctcatctacccgcaggcggtacgc
tggttcgtcgaggatcggctcgaactcgtcgccggccgcgtgagcctgcgcgacgcgccg
gcccaggacggcgaggcgctgctggtgcctgcgcccgagggcggagggcgggcgtga

DBGET integrated database retrieval system