KEGG   Thauera sp. MZ1T: Tmz1t_1824Help
Entry
Tmz1t_1824        CDS       T00804                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tmz  Thauera sp. MZ1T
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tmz00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tmz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2047166..2047822
Genome map
AA seq 218 aa AA seqDB search
MKSIVILISGRGSNMEAIVRAGIPGARIAAVISNRPGAGGLEFARAHGIATAVVDHKSHP
DRAGFDQALAECIDAHAPDLVVLAGFMRVLGDGFVRRYEGRLLNIHPSLLPAFPGLHTHR
RALETGVKVHGASVHFVTAELDDGPIVIQAAVPVLTGDDEDKLAARVLAQEHLIYPQAVR
WFVEDRLELVAGRVSLRDAPAQDGEALLVPAPEGGGRA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccatcgtcatcctcatttccggccgcggcagcaatatggaagccatcgtgcgt
gcgggcatcccgggcgcgcgtatcgccgcggtgatcagcaaccggccgggcgccggcggg
ctcgagttcgcacgcgcgcacggcatcgccaccgcggtcgtcgaccacaagtcccacccc
gaccgcgccggcttcgaccaggcgctcgccgagtgcatcgacgcccatgcgcccgacctg
gtcgtgctcgccgggttcatgcgcgtgctcggcgacggcttcgtgcgccgctacgaaggc
cgcctgctcaacatccacccctcgctgctgccggccttcccggggctgcacacccaccgc
cgcgcgctcgagaccggggtgaaggtgcatggcgcgagcgtgcatttcgtcaccgccgag
ctcgacgacgggccgatcgtgatccaggccgcggtgccggtgctgacgggcgacgacgag
gacaagctggccgcgcgcgtgctggcgcaggaacacctcatctacccgcaggcggtacgc
tggttcgtcgaggatcggctcgaactcgtcgccggccgcgtgagcctgcgcgacgcgccg
gcccaggacggcgaggcgctgctggtgcctgcgcccgagggcggagggcgggcgtga

DBGET integrated database retrieval system