KEGG   Thioalkalivibrio nitratireducens: TVNIR_1075Help
Entry
TVNIR_1075        CDS       T02408                                 

Gene name
dfrA_[H]
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TVNIR_1075 (dfrA_[H])
   00670 One carbon pool by folate
    TVNIR_1075 (dfrA_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TVNIR_1075 (dfrA_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(996582..997088)
Genome map
AA seq 168 aa AA seqDB search
MRDPDGIDPRLEIIVAMDPDRVIGRDNALPWHLPDDLRHFRRLTTGHTVVMGRRTHESIG
RPLPDRRNLVLTRQPGWAAPGVEVFAAFEEALAAADSGRVFVIGGAELFKAALPRAAVLH
LTRVHDRHPGDVRFPAFGDDWTLVWEEDHPPDERHSSGFTFQRLERSA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagggatccagatgggatcgatccgagactggagatcatcgtcgcgatggatccggac
cgggtgatcgggcgcgacaatgcgctcccctggcacctgcccgacgatctgcgccatttc
cggcgcttgaccaccggccacaccgtggtgatggggcgccgcacccacgaatccatcggt
cggccactgcccgaccggcgcaacctggtgttgacccgccagcccggatgggccgccccg
ggggtggaggtctttgcggccttcgaggaagccctggcagcggcggactccggccgcgtg
ttcgtcatcggcggtgcggaactcttcaaggcggcgctgccccgcgccgcagtgctgcac
ctgacccgggtccacgaccgccatccgggggacgtccggttcccggcgttcggcgacgac
tggacgctggtctgggaggaggaccaccctccggacgagcgccactccagcggcttcacg
ttccagcgcctggaacgcagcgcctga

DBGET integrated database retrieval system