KEGG   Thalassolituus oleivorans MIL-1: TOL_2624Help
Entry
TOL_2624          CDS       T02529                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tol  Thalassolituus oleivorans MIL-1
Brite
Enzymes [BR:tol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TOL_2624
Secretion system [BR:tol02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TOL_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2759943..2760803)
Genome map
AA seq 286 aa AA seqDB search
MKKTLIAAALGLLIGATANAEMTLKDAAEAKLVAAFGPDLKVREVAQLAKGQVLEVVLID
GSVMHMTPDLSYFTYRDELYELTARGAKSVTESRQEPMRAASLAAVPDRDTVVFPAKGEE
KAMINIFTDIDCGYCQKLHTEIPRLNELGIKVRYLAYPRSGIKDRETGQLTSSYEKINYV
WCQADRGTAMTDMKTTQRALNITGQRLSKASSPDQASTLEGEYRALQSQMTAMLASSKDC
HSPIAVQYELGQSVGVTGTPAIITEQGSLIPGYMPADDLAKRLGVL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccctgattgccgctgcgcttggactattaattggtgcaacggcaaatgct
gaaatgacactgaaggacgcagcagaagccaaattggttgctgctttcggacccgaccta
aaagtccgggaagtagcgcagttggctaaaggccaagtactagaagtggtattaatagat
ggcagtgtcatgcatatgacgccggatttaagctacttcacttatcgcgatgaattgtat
gagttgaccgctcgtggcgctaagagtgttactgaatctcgccaagaaccgatgcgcgca
gcgagtttggcggcggtacccgatcgtgacacagtggtcttcccggctaagggcgaggaa
aaagccatgattaacatcttcacggatattgattgtggttattgccaaaagttacacacc
gagattccacgtctaaatgaactaggtattaaagttcgctacttagcctacccacgctct
ggtattaaagatcgtgaaacggggcaattgacgtcatcctacgaaaaaatcaattacgtt
tggtgccaagctgatcgcggcaccgcgatgactgatatgaaaactactcagcgcgctttg
aatatcactggccagcgcttgtctaaggcgagtagtccagatcaggccagcactcttgaa
ggcgagtaccgtgcattacaatcgcaaatgacagcaatgcttgcgtctagcaaagactgc
cattctccgattgctgtccaatatgagttaggtcagtcggttggtgtcacgggtacgcct
gccattatcacagaacagggcagtctcattcctggttatatgccagcagatgatttagcg
aagcgattaggcgttttataa

DBGET integrated database retrieval system