KEGG   Thermodesulfobacterium geofontis: TOPB45_0450Help
Entry
TOPB45_0450       CDS       T01547                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TOPB45_0450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TOPB45_0450
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TOPB45_0450
Enzymes [BR:top01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TOPB45_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
453775..454566
Genome map
AA seq 263 aa AA seqDB search
MKKGAKLIEKRIRDLKEKGDIPFIPYITCWDPDLETTSAILWELAEIEPACIELGFPFSD
PVADGPTIQKAVVRALKNKPDFSAFFEFIEKLNQNKYPIPIVCMTYYNIIYRFGLEKTVE
SALASGLSGFIIADLPIEEAGPWLKANKGKGLATIFLAAPTSPEERIKKIAKKSSGFLYY
VSLTGITGARDKLPDDVVERLKMVKNQSLIPVAVGFGISKPEHVKMLSPYTDAIIIGSAI
VKIVEDKEKKAPKEIKKFLKSLK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggagctaaattaatagaaaaacgtataagagatttaaaagaaaagggagat
attccttttatcccttatataacttgctgggatccagatttagaaactacatctgctatt
ctctgggaacttgcagaaatagaacctgcttgtatagaacttggatttcctttttctgat
cctgttgcagatggtccaactattcaaaaagctgtagttagagctttaaaaaataagcct
gatttttccgcattttttgaatttatagaaaaactaaatcaaaataaatatcccatccct
atagtttgtatgacctattataatattatttatcgttttggcttagaaaaaacagttgaa
agtgctttagcttctggtctttcaggttttataatagctgatcttcctattgaagaagct
ggtccctggcttaaagcaaataaagggaaaggtcttgctaccatctttttggctgcacct
acttccccagaagaaaggattaaaaaaattgctaaaaaatcttctggatttttatattat
gtttctttaacaggaattactggagcaagagataaacttcctgatgatgtagtagaaaga
ttaaaaatggttaaaaaccagtctttgattcctgttgctgtaggatttggcatttcaaag
ccagaacatgtaaaaatgctttctccttatacagatgccattattataggaagtgctatt
gtaaaaattgtagaagataaagaaaaaaaggcacctaaggaaatcaagaaatttcttaaa
tctctaaaatga

DBGET integrated database retrieval system