KEGG   Thermodesulfobacterium sp. OPB45: TOPB45_0887Help
Entry
TOPB45_0887       CDS       T01547                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
top  Thermodesulfobacterium sp. OPB45
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:top01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:top01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:top00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(871659..873620)
Genome map
AA seq 653 aa AA seqDB search
MIIYKVLFIDVGSLRWEIKEYEIPPYLGPVEIGVKIHLEEIESWKYEIFSPQNVLFLGTG
PFAGSKIFGTHRLVAVFRSPESLGLHISEAGGVAYKFIGSGINGLVIYGKSEEPLLIFVE
GEEKTKVIFEKISFDNLNRIYEGYGNYFGAYALTKWLLDIYSDFYIENNARAVVVGPGAW
QTRFGSLVSIDVNPETKDLIIGSEDFAGRGGAGSILAQAHNVAGIIAGGKIKPQLPEILV
NIRNFNEFFKKITGREYFNAVNLATTKYRFDPKTGAGGTFGSNYPYYKEWLPTFGYNSIY
LKKEIRRKISDIVLKNYWEPFKEETFVKTKNWKTCGEPCSVACKKIWKRKKVDYEPFQGV
GPLIGVFDLKEASRIVDLIDNAGLDAITTGHIVSFLLEAVNRGLLTCEEVGISSHPNLDP
LILNPEKWHINGLLAEEIIQNLLNKKTPVLKDIAEKGLRKTIKILDQKYEERIEKAGTSF
KDIALYQPYGEDGYMTPNFYWTPGFFIPIFVNGKYWTEYRLIFTEPEEFVELVYERVIKE
LAISNAGFCRFHRGWAENFLEKLYEIFGIKNLEEKLKEVYKNIAIYNIKAGSIPKPLEGE
KAIDIFSTLAEELQVQRWNTKFSKDKRRAYQEWFERFFISYIYHVGLDFSLIK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgattatttataaagttctatttattgatgtaggttctctaagatgggaaataaaagaa
tatgaaatccctccttatttaggacctgttgaaattggagttaaaatccatttagaagaa
attgaaagctggaagtatgaaatatttagcccccaaaatgttttattccttggaacaggt
ccttttgctggaagcaaaatttttggaactcatagattggtagcagtttttagaagtcca
gaaagtttaggtcttcatatttctgaagctggaggagttgcctataagtttataggctct
ggtataaatggattggtcatttatggtaaaagtgaagaacctcttcttatttttgttgaa
ggagaagaaaaaaccaaagttatttttgaaaaaattagttttgataatttaaacagaata
tatgaaggttatgggaattattttggagcttatgctttaacaaagtggttattagatatt
tatagtgacttttacattgaaaataatgccagagcagtagttgttggtcctggagcatgg
caaacaagatttggttcccttgtttctatagatgtaaatcctgagacaaaagatttaatt
ataggaagtgaagattttgcaggcagaggaggagcaggctcaattttagctcaagcgcat
aatgtggcaggaataattgctggtggaaaaataaaacctcagcttcctgaaattttagta
aatattagaaactttaatgaattttttaaaaaaattacaggaagagaatattttaatgca
gttaatttagcaactactaaatatagatttgatcctaaaacaggagcaggaggaaccttt
ggttccaattatccctattataaggagtggcttcctactttcggttataatagtatttat
ttaaaaaaagaaataagaagaaaaatctccgatatagttttaaaaaactactgggaacct
tttaaggaagaaacctttgtaaaaactaaaaattggaaaacctgtggagaaccttgctca
gttgcctgtaaaaagatctggaaaagaaaaaaagtagattatgaaccattccaaggggtt
ggacctttaataggtgtttttgatctaaaagaagcttcacgaatagttgaccttatagat
aatgcaggtcttgatgccattactacaggacatatagtttcttttcttttagaggctgta
aatagaggattactaacttgtgaagaagtaggaatttcttctcatcccaatcttgatccc
ttaattttaaatcctgaaaaatggcatataaatgggctattagctgaagaaattattcaa
aacttacttaataaaaaaaccccagttttaaaagatattgcagaaaaggggttaagaaaa
acaataaaaattttagatcaaaaatatgaagaaagaattgaaaaagcagggacttctttt
aaagatatagctctttatcagccctatggagaggatggatatatgactcccaatttttat
tggactcctggcttcttcatccccatttttgttaatggaaaatactggactgaatataga
ttaatttttaccgaacctgaagaatttgtagaacttgtttatgaaagagtaattaaagaa
cttgctatttccaatgcaggattttgtagatttcatagaggttgggctgaaaattttctt
gaaaaactttatgaaatttttgggataaaaaatttagaagaaaaattaaaggaggtatat
aaaaatatagctatctataatattaaagctggttcaattcctaaacctcttgagggagaa
aaagccatagatatttttagcaccttagctgaagaactccaagttcaaagatggaataca
aaattttctaaagacaaaagaagggcttatcaagaatggtttgaaaggtttttcatttcc
tatatttatcatgtaggattagatttttccttaattaaataa

DBGET integrated database retrieval system