KEGG   Thermus oshimai: Theos_0344Help
Entry
Theos_0344        CDS       T02346                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
tos  Thermus oshimai
Pathway
tos03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tos00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Theos_0344
DNA repair and recombination proteins [BR:tos03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Theos_0344
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Theos_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 Prok-RING_4 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AFV75419
UniProt: K7R3E8
Position
complement(301714..302298)
Genome map
AA seq 194 aa AA seqDB search
MRYPESLLKLSRALARLPGVGPKTAQKLALFLAFHKEEAEGLREALEGLKALGVCQACGN
LAEGALCPICQDEGRDRRTIAVVETVADLYALERSGEFRGLYHVLGGALNPLEGIGPQAL
NLEGLFRRLQGVEEVVLATSMTVEGEATALYLAEELKKRGVRVSRPAYGLPVGGSLEYAD
EVTLGKALEGRRPL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcgctaccccgaaagcctcctcaagctttcccgcgccctggcccgcctgcccggggta
ggccccaagaccgcccagaagctggccctcttcctggccttccacaaggaggaggcggag
gggcttagggaggccctggaggggcttaaggccctgggggtctgccaggcgtgcggcaac
ctggcggaaggggcgctctgccccatctgccaggacgaaggccgcgaccggaggaccatc
gccgtggtggagaccgtggccgacctctacgccctggagcggagcggggagttccggggg
ctttaccacgtcctggggggggctctgaaccccctagagggcatcggcccccaggccctg
aacctggaggggcttttccggcggcttcagggggtggaggaggtggtcctggccacctcc
atgaccgtggaaggggaggccaccgccctttacctggcggaggagctcaagaagcggggg
gtcagggtgagccgacccgcctacggcctccccgtgggggggagcctggagtacgcggac
gaggtcaccctgggcaaggccctggaggggcggaggcccctctaa

DBGET integrated database retrieval system