KEGG   Tetrapisispora phaffii: TPHA_0H02250Help
Entry
TPHA_0H02250      CDS       T02235                                 

Gene name
TPHA0H02250
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpf00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tpf00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:532810..534357
Genome map
AA seq 515 aa AA seqDB search
MVTPSQVYRSTRSDSTETRSFEEAVLQGLATDGGLFIPPTIPHVSAETLKQWSKLSFQDL
AFEIMSLYIARDEIPSEDLKALVDRSYSTFRSKDVTPLVKNLTGSKENIHILELFHGPTY
AFKDVALQFVGNLFEYFLQRFNQGKQDSEKKKLTVVGATSGDTGSAAIYGLRGKKDVSVF
ILYPTGRISPIQEEQMTTVPDKNVQTLSVNGTFDNCQDIVKAIFGDKDFNSGHHVGAVNS
INWARILAQITYYFYSYFQVTDGKDEKVKFVVPSGNFGDILAGYFAKKMGLPIEKLVIAT
NENDILDRFLKSGTYERSDAVAATLSPAMDILISSNFERLLWFLARENLTANGSDDLKAG
EIVNNWFHQLKTAGKFIVDPKIIAGASVDFASERVSNEETISTIKDIYQNSENPKKYILD
PHTAVGVCATKRVIAKDSNDANLHYISLSTAHPAKFADAVNKALSEFEGYSFEKDVLPAE
LKKLSTLEKRLKFVEKPDIELVKNAIEEELVKMGL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtcactccatctcaagtttatagatcaaccagatcagactccactgaaaccagatcg
tttgaagaagctgttcttcaaggtttggctaccgatggtggtttgttcattccaccaacc
atcccacatgtttctgccgagactttaaaacaatggtctaaattgtccttccaagacttg
gcatttgaaattatgagtctatatatcgcaagggatgaaattccaagtgaagatttaaaa
gccttagttgatagatcttattctaccttccgttctaaggatgtcacaccattagtcaag
aatttgactggctctaaagaaaatatccacatcttagaattattccatggtccaacgtat
gctttcaaagatgttgctttacaatttgttggtaacttatttgaatatttcttacaaaga
ttcaatcaaggtaaacaagatagtgaaaagaagaagttgactgttgttggtgctacttct
ggtgacactggttctgccgctatctacgggttgagaggaaagaaagacgtttctgtgttt
attttatacccaaccggtagaatctctccaatccaagaggaacaaatgaccactgttcca
gacaaaaacgtccaaaccctatccgtcaacggtactttcgacaactgtcaagatatcgtg
aaagctatctttggtgacaaagatttcaactctggacatcatgttggtgctgttaattct
attaactgggcaagaattttagctcaaattacatattatttctactcatattttcaagtc
actgatggtaaagatgagaaagttaaatttgttgtaccaagtggtaactttggtgacatc
ttagctggttattttgccaagaaaatgggcttaccaatcgaaaaattagttattgccacg
aatgaaaatgatattttagacagattcttgaagtcaggtacctatgaaagatcagatgcc
gttgctgccactttatcgccagctatggacattttaatttcttctaattttgaaagatta
ctatggtttttagctagagaaaacttaacagccaacggttctgatgacttgaaggctggt
gaaattgtaaacaactggttccaccaattaaagactgcaggtaaatttattgtcgaccca
aagatcattgccggtgcttctgtagatttcgcttctgaaagggtctccaacgaggaaact
atctctaccatcaaggacatttaccaaaacagtgaaaaccctaaaaaatacattctagat
ccacacactgctgttggtgtctgtgccaccaagagagttattgccaaggattcaaacgac
gcaaaccttcactatatttctctatctacagctcatccagctaaatttgccgatgctgtc
aacaaagcattatctgaatttgaaggttactctttcgaaaaagatgttttaccagctgaa
ttaaagaagctatcgactttagaaaaaagattaaagtttgttgaaaaaccagatattgaa
ttagttaagaatgccattgaagaggaattagttaagatgggattataa

DBGET integrated database retrieval system