KEGG   Tetrapisispora phaffii: TPHA_0H02250Help
Entry
TPHA_0H02250      CDS       T02235                                 

Gene name
TPHA0H02250
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPHA_0H02250 (TPHA0H02250)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPHA_0H02250 (TPHA0H02250)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TPHA_0H02250 (TPHA0H02250)
Enzymes [BR:tpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TPHA_0H02250 (TPHA0H02250)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:532810..534357
Genome map
AA seq 515 aa AA seqDB search
MVTPSQVYRSTRSDSTETRSFEEAVLQGLATDGGLFIPPTIPHVSAETLKQWSKLSFQDL
AFEIMSLYIARDEIPSEDLKALVDRSYSTFRSKDVTPLVKNLTGSKENIHILELFHGPTY
AFKDVALQFVGNLFEYFLQRFNQGKQDSEKKKLTVVGATSGDTGSAAIYGLRGKKDVSVF
ILYPTGRISPIQEEQMTTVPDKNVQTLSVNGTFDNCQDIVKAIFGDKDFNSGHHVGAVNS
INWARILAQITYYFYSYFQVTDGKDEKVKFVVPSGNFGDILAGYFAKKMGLPIEKLVIAT
NENDILDRFLKSGTYERSDAVAATLSPAMDILISSNFERLLWFLARENLTANGSDDLKAG
EIVNNWFHQLKTAGKFIVDPKIIAGASVDFASERVSNEETISTIKDIYQNSENPKKYILD
PHTAVGVCATKRVIAKDSNDANLHYISLSTAHPAKFADAVNKALSEFEGYSFEKDVLPAE
LKKLSTLEKRLKFVEKPDIELVKNAIEEELVKMGL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtcactccatctcaagtttatagatcaaccagatcagactccactgaaaccagatcg
tttgaagaagctgttcttcaaggtttggctaccgatggtggtttgttcattccaccaacc
atcccacatgtttctgccgagactttaaaacaatggtctaaattgtccttccaagacttg
gcatttgaaattatgagtctatatatcgcaagggatgaaattccaagtgaagatttaaaa
gccttagttgatagatcttattctaccttccgttctaaggatgtcacaccattagtcaag
aatttgactggctctaaagaaaatatccacatcttagaattattccatggtccaacgtat
gctttcaaagatgttgctttacaatttgttggtaacttatttgaatatttcttacaaaga
ttcaatcaaggtaaacaagatagtgaaaagaagaagttgactgttgttggtgctacttct
ggtgacactggttctgccgctatctacgggttgagaggaaagaaagacgtttctgtgttt
attttatacccaaccggtagaatctctccaatccaagaggaacaaatgaccactgttcca
gacaaaaacgtccaaaccctatccgtcaacggtactttcgacaactgtcaagatatcgtg
aaagctatctttggtgacaaagatttcaactctggacatcatgttggtgctgttaattct
attaactgggcaagaattttagctcaaattacatattatttctactcatattttcaagtc
actgatggtaaagatgagaaagttaaatttgttgtaccaagtggtaactttggtgacatc
ttagctggttattttgccaagaaaatgggcttaccaatcgaaaaattagttattgccacg
aatgaaaatgatattttagacagattcttgaagtcaggtacctatgaaagatcagatgcc
gttgctgccactttatcgccagctatggacattttaatttcttctaattttgaaagatta
ctatggtttttagctagagaaaacttaacagccaacggttctgatgacttgaaggctggt
gaaattgtaaacaactggttccaccaattaaagactgcaggtaaatttattgtcgaccca
aagatcattgccggtgcttctgtagatttcgcttctgaaagggtctccaacgaggaaact
atctctaccatcaaggacatttaccaaaacagtgaaaaccctaaaaaatacattctagat
ccacacactgctgttggtgtctgtgccaccaagagagttattgccaaggattcaaacgac
gcaaaccttcactatatttctctatctacagctcatccagctaaatttgccgatgctgtc
aacaaagcattatctgaatttgaaggttactctttcgaaaaagatgttttaccagctgaa
ttaaagaagctatcgactttagaaaaaagattaaagtttgttgaaaaaccagatattgaa
ttagttaagaatgccattgaagaggaattagttaagatgggattataa

DBGET integrated database retrieval system