KEGG   Thalassiosira pseudonana: THAPSDRAFT_34210Help
Entry
THAPSDRAFT_34210  CDS       T01078                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
tps  Thalassiosira pseudonana
Brite
Chromosome and associated proteins [BR:tps03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    THAPSDRAFT_34210
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   THAPSDRAFT_34210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 7444889
NCBI-ProteinID: XP_002290856
JGI: 34210
UniProt: B5YMW8
Position
5
AA seq 120 aa AA seqDB search
MAKTPSKQAPAKAAKKAASGDKKKRSKKRVESYSTYIYKVLKQVHPDTGISKKGMSIMNS
FINDIFERIAGEAGKLSTYNKKATLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFSSA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaccctccaagcaagcacctgccaaggcagccaagaaagccgcctccggc
gacaaaaagaagcgctccaagaagcgtgtcgagagttactctacctacatctacaaggtg
ctcaagcaggtccaccccgacaccggaatctccaagaagggaatgtccatcatgaactcc
ttcatcaacgacatctttgaacgtattgctggcgaggctggcaagttgtcgacttacaat
aagaaggctacgctttcgtcgagggaaattcagacggcggttcgtcttatgctccccggt
gagctcgccaagcatgctgtgagtgagggtaccaaggccgtgacaaagttctcttctgcc
taa

DBGET integrated database retrieval system