KEGG   Thalassiosira pseudonana: THAPSDRAFT_34210Help
Entry
THAPSDRAFT_34210  CDS       T01078                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
tps  Thalassiosira pseudonana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 120 aa AA seqDB search
MAKTPSKQAPAKAAKKAASGDKKKRSKKRVESYSTYIYKVLKQVHPDTGISKKGMSIMNS
FINDIFERIAGEAGKLSTYNKKATLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFSSA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaccctccaagcaagcacctgccaaggcagccaagaaagccgcctccggc
gacaaaaagaagcgctccaagaagcgtgtcgagagttactctacctacatctacaaggtg
ctcaagcaggtccaccccgacaccggaatctccaagaagggaatgtccatcatgaactcc
ttcatcaacgacatctttgaacgtattgctggcgaggctggcaagttgtcgacttacaat
aagaaggctacgctttcgtcgagggaaattcagacggcggttcgtcttatgctccccggt
gagctcgccaagcatgctgtgagtgagggtaccaaggccgtgacaaagttctcttctgcc
taa

DBGET integrated database retrieval system