KEGG   Theileria parva: TP04_0219Help
Entry
TP04_0219         CDS       T00254                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpv  Theileria parva
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tpv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tpv00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tpv00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 681 aa AA seqDB search
MESNKRFSRFMLNRTSTDAANDDFEVVTSSYDVDSLYEPKPIPGHKFNITTFDQYERMYG
ESISNSDEFWGKIAKSSLHWISPYTKVSEGDFVDKNYAWFLNGKLNACYNCVDRWAEVRP
DSLAIIYEGDEPEDQRKVTFNELKMNVCKVANVLKMLGARKGDCVTIYMPTIPELCYSVL
ACARIGAVHSVVFGGFSATSLAERIHDSNSHIVITADGGMRATKHIKTKDIMDDALTRCS
FVTHCLVFRNIGSDVKMTPGRDVWMHEAMESVRPYCPVETMDSEDVLFILYTSGSTGKPK
GLAHTTGGYLVYAYATVRYIFDSHEGDVFGCMADVGWITGHTYVVYGPLLNGITTVMFGS
LPNYPTPDRYWNIVQEHGLTQFYTAPTAIRSLMKFGDEPLKGHNLSSLRVLGSVGEPINP
EAWKWYYNVVGNGKVAVVDSYWQTETGGIIISPIPGVTFTKPGSATYPFFGIELAIIDAN
TGEELEGNNCSGLLCIKKPWPGMFRTIFGDHSRIHETYFPTKYPYYFTGDGAFRDKHGYI
WISGRIDDTINVSGHRLCSAEIEYALTQVDIVSEAAVVGYPHALKGQGIFCFVSLKEASL
RLPKEEVIGRLKMSIRHYVGPFATPDVVLITPNLPKTRSGKIMRRILRRLASKKFHDFGD
VSTLANPEVVHQLIEDVKQVQ
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaataaaagattttcgaggtttatgctcaacaggacgtcaactgatgccgca
aacgatgactttgaagtcgtcacctcatcctatgacgtcgactctctatacgaacccaaa
cccatccccggacataaattcaatatcaccactttcgaccagtatgagcgtatgtacgga
gagagtatttctaatagtgacgagttttggggtaagatagcaaagtcaagtttacactgg
atttcgccctatactaaggtgtctgagggcgactttgtggataaaaactacgcctggttc
ctgaatgggaagttgaacgcatgttacaattgtgtcgaccgttgggctgaagtaagacca
gactcattggctattatttacgaaggcgacgagcctgaagaccagaggaaggtgacattt
aatgagctgaagatgaatgtgtgtaaagtggctaatgtgcttaaaatgctcggtgctcgc
aagggcgattgcgttacaatttacatgcccacaattccagaactctgctactctgtcctt
gcatgtgctcgcatcggagctgttcattctgttgtctttggtggtttctcagccacttca
ctcgctgaaagaattcatgactccaattcacatatcgtcataactgctgatggaggaatg
agagcgactaagcatataaagactaaggatataatggatgacgccttgacacgttgttca
tttgtaactcattgtcttgtattccgaaacattggatcggacgtgaaaatgacacctggc
agggatgtatggatgcatgaggccatggagtcggttagaccatactgcccagttgaaacc
atggacagtgaagacgttttattcattctctatacatcaggatctaccggtaaacctaag
ggattagcgcatactacgggaggatatttggtatatgcatatgcgacagttaggtacatt
tttgatagccatgaaggcgacgtgttcgggtgcatggcagacgtcgggtggattacaggc
catacgtacgtggtttacgggccgctgctgaacggcataacgacggtgatgttcggttcc
ttgccgaattatccaaccccagaccgttattggaacattgtgcaggagcacgggttgacg
caattttatacagcaccaacagcgattaggagtctgatgaaatttggagacgagccactg
aagggacataatttgagtagtttgagagttttaggaagcgtgggagaaccaatcaaccca
gaggcgtggaagtggtattacaatgtagttgggaatggaaaagtggcagtggttgactcg
tactggcaaactgagactggaggaataatcatctcaccgatcccaggagtgaccttcaca
aagccgggctcggccacttaccccttttttggcatagaattggccataattgacgcaaat
acgggcgaggagttggaggggaataattgttcgggacttttgtgtataaagaagccttgg
ccaggcatgtttaggacgatttttggtgaccattcgagaatccatgagacctatttcccc
accaaatacccctactatttcaccggtgacggagcgtttagagacaagcatgggtatatt
tggatttcaggccgcattgacgacactattaatgtttcaggccacaggctctgtagcgca
gaaattgaatatgcactgactcaagttgacattgtgtcagaggctgcagtggtcgggtac
ccgcacgcactcaagggccagggtatcttctgtttcgtctcattgaaggaggcaagtctg
aggcttcccaaggaggaggtgattggcaggcttaagatgagtattaggcactatgtgggc
cctttcgcaacgcccgacgttgttctgatcacgcccaatcttccgaaaaccaggagtggg
aaaattatgcgtaggatcctcaggagattggcgtccaagaagttccacgacttcggcgac
gtctccaccctcgctaaccctgaagttgtacaccaactcatcgaggacgtcaaacaagtc
caataa

DBGET integrated database retrieval system