KEGG   Theileria parva: TP04_0219Help
Entry
TP04_0219         CDS       T00254                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpv  Theileria parva
Pathway
tpv00010  Glycolysis / Gluconeogenesis
tpv00620  Pyruvate metabolism
tpv00640  Propanoate metabolism
tpv01100  Metabolic pathways
tpv01110  Biosynthesis of secondary metabolites
tpv01130  Biosynthesis of antibiotics
tpv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TP04_0219
   00620 Pyruvate metabolism
    TP04_0219
   00640 Propanoate metabolism
    TP04_0219
Enzymes [BR:tpv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TP04_0219
Lipid biosynthesis proteins [BR:tpv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TP04_0219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 3500858
NCBI-ProteinID: XP_763854
UniProt: Q4N2X3
Position
4
AA seq 681 aa AA seqDB search
MESNKRFSRFMLNRTSTDAANDDFEVVTSSYDVDSLYEPKPIPGHKFNITTFDQYERMYG
ESISNSDEFWGKIAKSSLHWISPYTKVSEGDFVDKNYAWFLNGKLNACYNCVDRWAEVRP
DSLAIIYEGDEPEDQRKVTFNELKMNVCKVANVLKMLGARKGDCVTIYMPTIPELCYSVL
ACARIGAVHSVVFGGFSATSLAERIHDSNSHIVITADGGMRATKHIKTKDIMDDALTRCS
FVTHCLVFRNIGSDVKMTPGRDVWMHEAMESVRPYCPVETMDSEDVLFILYTSGSTGKPK
GLAHTTGGYLVYAYATVRYIFDSHEGDVFGCMADVGWITGHTYVVYGPLLNGITTVMFGS
LPNYPTPDRYWNIVQEHGLTQFYTAPTAIRSLMKFGDEPLKGHNLSSLRVLGSVGEPINP
EAWKWYYNVVGNGKVAVVDSYWQTETGGIIISPIPGVTFTKPGSATYPFFGIELAIIDAN
TGEELEGNNCSGLLCIKKPWPGMFRTIFGDHSRIHETYFPTKYPYYFTGDGAFRDKHGYI
WISGRIDDTINVSGHRLCSAEIEYALTQVDIVSEAAVVGYPHALKGQGIFCFVSLKEASL
RLPKEEVIGRLKMSIRHYVGPFATPDVVLITPNLPKTRSGKIMRRILRRLASKKFHDFGD
VSTLANPEVVHQLIEDVKQVQ
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaataaaagattttcgaggtttatgctcaacaggacgtcaactgatgccgca
aacgatgactttgaagtcgtcacctcatcctatgacgtcgactctctatacgaacccaaa
cccatccccggacataaattcaatatcaccactttcgaccagtatgagcgtatgtacgga
gagagtatttctaatagtgacgagttttggggtaagatagcaaagtcaagtttacactgg
atttcgccctatactaaggtgtctgagggcgactttgtggataaaaactacgcctggttc
ctgaatgggaagttgaacgcatgttacaattgtgtcgaccgttgggctgaagtaagacca
gactcattggctattatttacgaaggcgacgagcctgaagaccagaggaaggtgacattt
aatgagctgaagatgaatgtgtgtaaagtggctaatgtgcttaaaatgctcggtgctcgc
aagggcgattgcgttacaatttacatgcccacaattccagaactctgctactctgtcctt
gcatgtgctcgcatcggagctgttcattctgttgtctttggtggtttctcagccacttca
ctcgctgaaagaattcatgactccaattcacatatcgtcataactgctgatggaggaatg
agagcgactaagcatataaagactaaggatataatggatgacgccttgacacgttgttca
tttgtaactcattgtcttgtattccgaaacattggatcggacgtgaaaatgacacctggc
agggatgtatggatgcatgaggccatggagtcggttagaccatactgcccagttgaaacc
atggacagtgaagacgttttattcattctctatacatcaggatctaccggtaaacctaag
ggattagcgcatactacgggaggatatttggtatatgcatatgcgacagttaggtacatt
tttgatagccatgaaggcgacgtgttcgggtgcatggcagacgtcgggtggattacaggc
catacgtacgtggtttacgggccgctgctgaacggcataacgacggtgatgttcggttcc
ttgccgaattatccaaccccagaccgttattggaacattgtgcaggagcacgggttgacg
caattttatacagcaccaacagcgattaggagtctgatgaaatttggagacgagccactg
aagggacataatttgagtagtttgagagttttaggaagcgtgggagaaccaatcaaccca
gaggcgtggaagtggtattacaatgtagttgggaatggaaaagtggcagtggttgactcg
tactggcaaactgagactggaggaataatcatctcaccgatcccaggagtgaccttcaca
aagccgggctcggccacttaccccttttttggcatagaattggccataattgacgcaaat
acgggcgaggagttggaggggaataattgttcgggacttttgtgtataaagaagccttgg
ccaggcatgtttaggacgatttttggtgaccattcgagaatccatgagacctatttcccc
accaaatacccctactatttcaccggtgacggagcgtttagagacaagcatgggtatatt
tggatttcaggccgcattgacgacactattaatgtttcaggccacaggctctgtagcgca
gaaattgaatatgcactgactcaagttgacattgtgtcagaggctgcagtggtcgggtac
ccgcacgcactcaagggccagggtatcttctgtttcgtctcattgaaggaggcaagtctg
aggcttcccaaggaggaggtgattggcaggcttaagatgagtattaggcactatgtgggc
cctttcgcaacgcccgacgttgttctgatcacgcccaatcttccgaaaaccaggagtggg
aaaattatgcgtaggatcctcaggagattggcgtccaagaagttccacgacttcggcgac
gtctccaccctcgctaaccctgaagttgtacaccaactcatcgaggacgtcaaacaagtc
caataa

DBGET integrated database retrieval system