KEGG   Turneriella parva: Turpa_3189Help
Entry
Turpa_3189        CDS       T02157                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpx  Turneriella parva
Pathway
tpx00020  Citrate cycle (TCA cycle)
tpx00310  Lysine degradation
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01130  Biosynthesis of antibiotics
tpx01200  Carbon metabolism
Module
tpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Turpa_3189
  Amino acid metabolism
   00310 Lysine degradation
    Turpa_3189
Enzymes [BR:tpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Turpa_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFM13828
UniProt: I4B971
Position
complement(3342237..3343445)
Genome map
AA seq 402 aa AA seqDB search
MADVEVKVPAMGESISEGTISRWFKKEGEAIKADEALFEIETDKVTQEIYAPVSGVVKKL
QKAQGANAAVGETVAVIDSSASAAAAPAEKPAAPAAATAPKQQPMAETLPPAAKKLATEK
GVDTSAIAGSGKHGQVTKGDVLEAAAQKQAAPAPAQPARVVTVAPGERETVQPMSRLRRA
IAERLVSAQQTAAILTTFNEVDMKPAMDLRAKHNEDFQKKYGVKIGFMSLFTKAVVSALK
EVPAINAEIRGNDIVYKNYYDIGVAVGGPRGLVVPIVRGADQLNFSEIEIEISRLAARVK
EGSITLPEMEGGTFTISNGGIYGSMMSTPILNPPQSGILGMHNIVKRAVVVSEGNTDKIE
IRPMMYIALSYDHRIVDGKEAVTFLVKVKQAIEDPVRLLLGV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtcgaagttaaggtaccggcaatgggtgaatcgatcagcgagggcactatc
tcgcgctggttcaagaaagagggtgaggccataaaggcagacgaagcactctttgagatt
gagaccgataaagtcacacaagaaatttatgccccggtcagcggcgtcgtgaagaaactg
caaaaagcgcagggagccaatgcggctgtcggcgaaaccgtcgccgtgatcgattcttca
gccagcgcagcggctgcaccggcggagaaacctgctgcccccgcagccgcaacagcacca
aaacagcaaccgatggctgagacactgccgcctgccgcaaaaaaactagcgaccgaaaag
ggtgtagacacttcagccatcgcaggctcaggtaagcatggccaggtaaccaaaggtgac
gtactcgaagcggccgcacaaaaacaggcggcccctgccccggctcagccggcacgcgtc
gtaactgtggcgccaggtgaacgcgaaactgttcagccgatgtcgcgcctgaggcgtgca
atcgccgaacgcctggtttcggcgcagcagacggcggcgattcttacgaccttcaacgaa
gtcgacatgaaacccgcgatggatctgcgcgccaaacacaacgaagactttcagaagaaa
tatggcgtgaagatcggcttcatgagcctctttacgaaagctgtcgtcagcgcgctcaaa
gaagtgcccgcgattaacgctgaaatacgcggcaacgacatcgtctacaagaactattac
gatatcggcgtggcagtcggtggcccgcgtggtttggttgtgccgattgtgcgcggcgca
gaccagctgaatttttctgagattgagattgagatcagccgtctcgcggcacgcgtcaaa
gaaggcagcattactttacccgaaatggaaggcggcaccttcacgatttcgaatggcggc
atctatggctcgatgatgtcgaccccgatattgaatccgccgcagagcggcattctcggc
atgcacaatatcgtgaagcgagccgtcgtggtgagcgaaggcaacaccgataagatcgaa
atccgcccgatgatgtatattgcactctcgtacgaccaccgtatcgttgatggtaaagag
gccgtgaccttcttggtcaaggtcaaacaggcgattgaagatccggtgagattacttctg
ggcgtctga

DBGET integrated database retrieval system