KEGG   Turneriella parva: Turpa_3189Help
Entry
Turpa_3189        CDS       T02157                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpx  Turneriella parva
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Turpa_3189
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Turpa_3189
  Amino acid metabolism
   00310 Lysine degradation
    Turpa_3189
Enzymes [BR:tpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Turpa_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3342237..3343445)
Genome map
AA seq 402 aa AA seqDB search
MADVEVKVPAMGESISEGTISRWFKKEGEAIKADEALFEIETDKVTQEIYAPVSGVVKKL
QKAQGANAAVGETVAVIDSSASAAAAPAEKPAAPAAATAPKQQPMAETLPPAAKKLATEK
GVDTSAIAGSGKHGQVTKGDVLEAAAQKQAAPAPAQPARVVTVAPGERETVQPMSRLRRA
IAERLVSAQQTAAILTTFNEVDMKPAMDLRAKHNEDFQKKYGVKIGFMSLFTKAVVSALK
EVPAINAEIRGNDIVYKNYYDIGVAVGGPRGLVVPIVRGADQLNFSEIEIEISRLAARVK
EGSITLPEMEGGTFTISNGGIYGSMMSTPILNPPQSGILGMHNIVKRAVVVSEGNTDKIE
IRPMMYIALSYDHRIVDGKEAVTFLVKVKQAIEDPVRLLLGV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtcgaagttaaggtaccggcaatgggtgaatcgatcagcgagggcactatc
tcgcgctggttcaagaaagagggtgaggccataaaggcagacgaagcactctttgagatt
gagaccgataaagtcacacaagaaatttatgccccggtcagcggcgtcgtgaagaaactg
caaaaagcgcagggagccaatgcggctgtcggcgaaaccgtcgccgtgatcgattcttca
gccagcgcagcggctgcaccggcggagaaacctgctgcccccgcagccgcaacagcacca
aaacagcaaccgatggctgagacactgccgcctgccgcaaaaaaactagcgaccgaaaag
ggtgtagacacttcagccatcgcaggctcaggtaagcatggccaggtaaccaaaggtgac
gtactcgaagcggccgcacaaaaacaggcggcccctgccccggctcagccggcacgcgtc
gtaactgtggcgccaggtgaacgcgaaactgttcagccgatgtcgcgcctgaggcgtgca
atcgccgaacgcctggtttcggcgcagcagacggcggcgattcttacgaccttcaacgaa
gtcgacatgaaacccgcgatggatctgcgcgccaaacacaacgaagactttcagaagaaa
tatggcgtgaagatcggcttcatgagcctctttacgaaagctgtcgtcagcgcgctcaaa
gaagtgcccgcgattaacgctgaaatacgcggcaacgacatcgtctacaagaactattac
gatatcggcgtggcagtcggtggcccgcgtggtttggttgtgccgattgtgcgcggcgca
gaccagctgaatttttctgagattgagattgagatcagccgtctcgcggcacgcgtcaaa
gaaggcagcattactttacccgaaatggaaggcggcaccttcacgatttcgaatggcggc
atctatggctcgatgatgtcgaccccgatattgaatccgccgcagagcggcattctcggc
atgcacaatatcgtgaagcgagccgtcgtggtgagcgaaggcaacaccgataagatcgaa
atccgcccgatgatgtatattgcactctcgtacgaccaccgtatcgttgatggtaaagag
gccgtgaccttcttggtcaaggtcaaacaggcgattgaagatccggtgagattacttctg
ggcgtctga

DBGET integrated database retrieval system