KEGG   Thermacetogenium phaeum: Tph_c06680Help
Entry
Tph_c06680        CDS       T02276                                 

Gene name
glkA
Definition
glucokinase GlkA (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tph_c06680 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c06680 (glkA)
   00052 Galactose metabolism
    Tph_c06680 (glkA)
   00500 Starch and sucrose metabolism
    Tph_c06680 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    Tph_c06680 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tph_c06680 (glkA)
   00524 Butirosin and neomycin biosynthesis
    Tph_c06680 (glkA)
Enzymes [BR:tpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tph_c06680 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697913..698875
Genome map
AA seq 320 aa AA seqDB search
MSNVLAVDLGGTKIRSALVTPGGEIVAEDVRLTEACLGFKGVADRILAGMAAVAAGRDTC
GAGLAVPAYLEPGTERILFAPNLKWRNVDLKRELEDALGLPVWLENDANLAALGEHRYGA
GRGFKDLVYITVSTGVGSGLVLGGRLYNGAYGGAGEFGHMVVDPEGPFCSCGNRGCLEGV
ASGCAIKRKAQELIKSGSGRRMLELAGGDLSAVDSRIVGLAAREGDSEARSILASAGRYL
GIAIASVANLLNPAVFIVGGGVARGVGNYLLEPAVEEAYRHVYPPYRGSLKILPAALEGR
EGVLGAAVFALERLAGSCNG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtcttggcggtggacctggggggaaccaagatccgttcggcgctggtgact
ccgggaggagagattgtcgcggaggatgtccgccttacagaggcctgtctgggtttcaaa
ggggttgccgaccgcatcctggcggggatggcggcggttgccgcaggcagggacacctgt
ggagcggggttggccgtgcccgcttacctggaaccgggcacggagcggatcctctttgca
ccgaatttgaaatggcggaacgtggatttaaaaagggaactggaagatgctctggggttg
cccgtctggctggagaacgacgccaacctggctgctctgggggagcaccgctacggtgcg
gggcgggggtttaaggatctggtttatatcaccgtcagcacgggggtcgggagcggattg
gttctgggcggcaggctttataacggcgcttacggcggtgccggggagttcgggcacatg
gttgttgacccggagggccccttttgttcctgcgggaacagaggttgtctggagggagtt
gcctctgggtgcgccattaaaagaaaggcccaggaactgataaaatccggaagcggtaga
aggatgctcgaactggctggtggagatctctctgccgtcgattcccggatagtcgggctg
gccgcccgggaaggcgactccgaggccaggtcgattttggcgtcggccggacgctacctg
gggattgctatagccagtgttgccaaccttcttaacccggcggtgtttatcgtcggcgga
ggggttgctcgcggtgtggggaattacctgctggagcccgccgttgaagaggcctatcgc
cacgtctatcctccctaccgggggtcgctgaagattctccctgccgctctggagggcagg
gagggtgtcctgggagcggcggttttcgcccttgagcggctggccggtagctgtaatggc
tga

DBGET integrated database retrieval system