KEGG   Thermomicrobium roseum: trd_A0877Help
Entry
trd_A0877         CDS       T00845                                 

Definition
(GenBank) endoglucanase M (EGM) (Endo-1,4-beta-glucanase)(Cellulase M)
Organism
tro  Thermomicrobium roseum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
unnamed:859094..860152
Genome map
AA seq 352 aa AA seqDB search
MDLDWELLRRLCEAPGIPGHEERIAGVVRAALQPLVDEFHVDAMGNLIGRRRGRSDRRVM
LAAHMDEIGFLVRHIDEQGFLRLQSVGGFDARVLVAQRVHVWPRTGDPLLGALQLATKPI
HLLAQEERKAPTMEDLYVDLGLPADEVRARVEIGDMVTLGRDFARLGPTVLSKALDDRVG
LFVMLESLRHLEHHEADIVAVATVQEEVGLRGAQTAAFGLEPHVGIALDVTIAGDVPGID
PKDRVTSLGAGVALKVFDTSHLPSRPLLQHLREIAEREGIRYQLEVLPRGGTDAGALQRA
RAGIPVVTLSIPTRHVHTVNEMAHIEDIAAAVQLLTRYLAEAHERSYHPYAW
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgactgggaactcctgcggaggctctgcgaggcacctggtatccccggacac
gaggagcggatcgcgggggtcgtgcgggctgctctccagccgctcgtcgatgagttccac
gtcgatgccatgggcaatctcatcggcaggcgccgcggccgcagcgatcgccgcgtcatg
ctcgctgcccacatggacgaaatcggcttcctcgttcgtcacatcgacgagcaaggcttt
cttcgtctccaatcggttggcggcttcgatgcccgcgtcctggtcgcccagcgcgtccac
gtgtggccccgcaccggtgatccgctcctcggcgcgctccagctcgcgacgaagccgatc
catctgctcgctcaggaagagcgcaaagcgccgacgatggaggacctgtacgtcgatctc
ggattacccgctgacgaggtacgcgctcgcgtcgagatcggcgacatggtcaccctgggc
cgcgacttcgctcgcctcggaccgacggtgctcagcaaggccctcgacgatcgtgtcggg
ctgttcgtgatgctggaatctctccgtcatctcgaacaccacgaggcggatatcgtcgcg
gtcgccactgtccaggaggaagttggcctacgcggcgctcagaccgcagcgttcgggctc
gaaccccacgtcgggatcgcgctggatgtcaccatcgccggtgacgttccgggcatcgac
cccaaggatcgtgtcacctctctcggagcaggtgtcgctctcaaggttttcgatacgtcc
catctccccagccggccgcttctccagcacctgcgcgagatcgccgagcgggagggtatc
cgctaccagctcgaagtcctcccgcgtgggggtaccgatgctggcgctctccagcgcgcc
cgagccggtattccggtcgtcacgctttccattcccacccgtcacgtgcacacggtcaac
gaaatggcgcacatcgaggacatcgctgcagccgttcagctgctcacgcgctacctcgcc
gaagcgcacgagcgttcctatcacccctacgcatggtga

DBGET integrated database retrieval system