KEGG   Thermomicrobium roseum: trd_A0877Help
Entry
trd_A0877         CDS       T00845                                 

Definition
endoglucanase M (EGM) (Endo-1,4-beta-glucanase)(Cellulase M) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tro  Thermomicrobium roseum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    trd_A0877
Enzymes [BR:tro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     trd_A0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:859094..860152
Genome map
AA seq 352 aa AA seqDB search
MDLDWELLRRLCEAPGIPGHEERIAGVVRAALQPLVDEFHVDAMGNLIGRRRGRSDRRVM
LAAHMDEIGFLVRHIDEQGFLRLQSVGGFDARVLVAQRVHVWPRTGDPLLGALQLATKPI
HLLAQEERKAPTMEDLYVDLGLPADEVRARVEIGDMVTLGRDFARLGPTVLSKALDDRVG
LFVMLESLRHLEHHEADIVAVATVQEEVGLRGAQTAAFGLEPHVGIALDVTIAGDVPGID
PKDRVTSLGAGVALKVFDTSHLPSRPLLQHLREIAEREGIRYQLEVLPRGGTDAGALQRA
RAGIPVVTLSIPTRHVHTVNEMAHIEDIAAAVQLLTRYLAEAHERSYHPYAW
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgactgggaactcctgcggaggctctgcgaggcacctggtatccccggacac
gaggagcggatcgcgggggtcgtgcgggctgctctccagccgctcgtcgatgagttccac
gtcgatgccatgggcaatctcatcggcaggcgccgcggccgcagcgatcgccgcgtcatg
ctcgctgcccacatggacgaaatcggcttcctcgttcgtcacatcgacgagcaaggcttt
cttcgtctccaatcggttggcggcttcgatgcccgcgtcctggtcgcccagcgcgtccac
gtgtggccccgcaccggtgatccgctcctcggcgcgctccagctcgcgacgaagccgatc
catctgctcgctcaggaagagcgcaaagcgccgacgatggaggacctgtacgtcgatctc
ggattacccgctgacgaggtacgcgctcgcgtcgagatcggcgacatggtcaccctgggc
cgcgacttcgctcgcctcggaccgacggtgctcagcaaggccctcgacgatcgtgtcggg
ctgttcgtgatgctggaatctctccgtcatctcgaacaccacgaggcggatatcgtcgcg
gtcgccactgtccaggaggaagttggcctacgcggcgctcagaccgcagcgttcgggctc
gaaccccacgtcgggatcgcgctggatgtcaccatcgccggtgacgttccgggcatcgac
cccaaggatcgtgtcacctctctcggagcaggtgtcgctctcaaggttttcgatacgtcc
catctccccagccggccgcttctccagcacctgcgcgagatcgccgagcgggagggtatc
cgctaccagctcgaagtcctcccgcgtgggggtaccgatgctggcgctctccagcgcgcc
cgagccggtattccggtcgtcacgctttccattcccacccgtcacgtgcacacggtcaac
gaaatggcgcacatcgaggacatcgctgcagccgttcagctgctcacgcgctacctcgcc
gaagcgcacgagcgttcctatcacccctacgcatggtga

DBGET integrated database retrieval system