KEGG   Thermotoga sp. RQ2: TRQ2_0988Help
Entry
TRQ2_0988         CDS       T00706                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
trq  Thermotoga sp. RQ2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TRQ2_0988
  Lipid metabolism
   00561 Glycerolipid metabolism
    TRQ2_0988
   00600 Sphingolipid metabolism
    TRQ2_0988
Enzymes [BR:trq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TRQ2_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1034252..1035694
Genome map
AA seq 480 aa AA seqDB search
MPSVKIGIIGAGSAVFSLRLVSDLCKTPGLSGSTVTLMDIDEERLDAILTIAKKYVEEVG
ADLKFEKTMNLDDVIIDADFVINTAMVGGHTYLEKVRQIGEKYGYYRGIDAQEFNMVSDY
YTFSNYNQLKYFVDIARKIEKLSPKAWYLQAANPVFEGTTLVTRTVPIKAVGFCHGHYGV
MEIVEKLGLEEEKVDWQVAGVNHGIWLNRFRYNGENAYPLLDRWIEEKSKDWKPENPFND
QLSPAAIDMYRFYGVMPIGDTVRNSSWRYHRDLETKKKWYGEPWGGADSEIGWKWYQDTL
GKVTEITKKVAKFIKENPSARLSDLGSVLGKDLSEKQFVLEVEKILDPERKSGEQHIPFI
DALLNDNKARFVVNIPNKGIIHGIDDDVVVEVPALVDKNGIHPEKIEPPLPDRVVKYYLR
PRIMRMEMALEAFLTGDIRIIKELLYRDPRTKNDEQVEKVIEEILALSENEEMRKHYLKR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgtgaagatcggtatcatcggtgcggggagcgcggtgttttctctgaggctt
gtgagtgatctttgcaaaacgccgggactctctggcagcacggtcaccctcatggatatc
gacgaagaaagactcgacgctattctgaccatcgcgaaaaaatacgttgaagaagtggga
gcggatctgaaattcgaaaaaaccatgaatttagatgacgtcatcatcgacgcggatttt
gtgataaacacagcgatggtgggtggccatacctacttggagaaggtcagacagatcggt
gagaaatacggctactacagaggaatagacgctcaggagtttaacatggtctccgactac
tacaccttctccaactacaaccagctcaagtacttcgttgacatagcaaggaagatagag
aagctctccccaaaagcctggtacttgcaggcagcgaaccccgttttcgagggaacaacc
cttgtgacaagaacggttcccataaaggcagtgggattctgccatggacactacggcgtg
atggagatcgtagagaaactggggctggaagaagaaaaagtagattggcaggtcgcagga
gtgaaccacggtatctggctgaataggttcagatacaacggggagaacgcgtatcccctc
cttgacaggtggatcgaggaaaaatcaaaagattggaaaccagagaaccccttcaacgat
cagctctctcccgctgcgatagatatgtacagattctacggtgtgatgcccatcggtgac
accgtgagaaactcttcgtggaggtaccacagggatcttgagaccaagaagaaatggtac
ggtgaaccctggggaggagcagattctgaaataggctggaaatggtaccaggacacactt
ggaaaggtaacggagatcacaaagaaggtggcaaagttcatcaaagaaaatccgtccgcg
aggctctccgaccttggaagtgttctgggaaaagacctctcagaaaagcagtttgtgctc
gaagtagagaaaatcctcgatccagaaagaaagagtggagagcagcacatcccattcatc
gatgcgctgttgaacgataacaaggcaagattcgtggtgaacataccaaataaaggtatc
attcacggaatagacgatgacgtggttgttgaagtcccagcccttgtggacaagaacgga
atccatcccgagaagatcgaaccaccgcttccagatcgcgtggtcaagtactacctgaga
ccaaggatcatgagaatggaaatggctctggaggcgttcctcacgggggacataaggatc
ataaaagaacttctctacagagatccaagaacgaagaacgacgaacaggtagaaaaggtg
atcgaggaaatcctcgcactctcggaaaacgaagagatgcggaaacattatctgaagaga
tga

DBGET integrated database retrieval system