KEGG   Takifugu rubripes (torafugu): 101074582Help
Entry
101074582         CDS       T02386                                 

Definition
chymotrypsin A-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101074582
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101074582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 263 aa AA seqDB search
MAFLWILSCLALAGATYGCGVPGISPVITGYSRIVNGEEAVPHSWPWQVSLQDYTGFHFC
GGSLINENWVVTAAHCNVRTSHRVILGEHDRSSSNEAIQVMKVGKVFKHPKYNSYTINND
ILLIKLASPAQLNVRVSPVCVAETSDNFPGGMRCVTSGWGLTRYNAPDTPALLQQAALPL
LTNERCRQFWGSKITDLMICAGASGASSCMGDSGGPLVCEKAGAWTLVGIVSWGSGFCSV
SSPGVYARVTMLRAWMDQIIAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctgtggatcctctcctgtcttgcccttgcaggggctacttacggttgcggc
gttcctggcatctctcctgttatcaccggatactctcgtattgttaatggtgaggaggca
gtgcctcactcttggccctggcaggtgtctctgcaggattacactggttttcacttctgt
gggggctctctgatcaatgagaactgggtggtgacagctgctcactgcaatgtcagaacg
tcccaccgtgtgatccttggagagcatgatcgctcttccagtaacgaggccatccaggtg
atgaaagttggaaaggttttcaaacacccaaagtacaatagctacaccatcaacaatgac
atcctgctcatcaagttggcgagccccgcccagttgaacgtacgcgtgtcacctgtgtgc
gtggctgagacctcagataacttccctggtggcatgaggtgtgtgaccagcggctggggc
ttgactcgctacaatgctcccgacaccccagctctcttgcaacaggctgctctccccctg
ctgaccaatgagaggtgccgtcagttctggggcagcaagatcacagatctgatgatctgc
gctggagcctccggagcctcctcatgcatgggtgactccggtggtcctctggtctgtgag
aaggcgggagcttggactctggttggtattgtgtcttggggcagtggattctgcagcgtg
tcttcacctggtgtgtacgctcgtgtcaccatgttgcgtgcctggatggaccagatcatt
gctgccaactga

DBGET integrated database retrieval system