KEGG   Takifugu rubripes (torafugu): 101078125Help
Entry
101078125         CDS       T02386                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tru00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tru04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tru04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 773 aa AA seqDB search
MRSPEPSSPSTAEALLHSQFASWGSHGSGSGNNNSCPNSPGGQVGLSPAASPTPSLASNY
ALTLTHTHIHIQRLATRSGKEARLMLPLAELVGCSCPRAPAPPLLVLYWYPPGKKRKGVS
RRRQVRAYLAESRTEAERWAAAVQCLLRDVTVTADTEFSRRLLPRPRRLMLLVNPFSGRG
QAMQWCQTQILPMIREANISYNLIQTERQNHARELIREISLPEWDGIVIVSGDGLLHEVI
NGLMERPDWEQAIKIPVGILPCGSGNALAGSINHNAGYDMCLRESLLLNCCFLLCRGGVR
PMDVVSVTTSPPPSSNNHPAAPKRLFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLV
RIASLRSYKGRLSFLPPSCTSSPDATPPPPRRALSRSITEGLEGFCRPPIHRTCSDMGIS
EQRSLRRGEGEWERDERQRERERRRERARGGGTGVVRASSLAEDREKEERLAVIKDEREN
KGNAQEEDEDGGQDGRGRVQSDGKEGALPPDKPGDGCEVDMGKEADEQVDSPYQDELQGV
RQALRKNSAPSSQISSALFNQPLGQVTCPDSNASYGVEDMDLNGTYYQKEAYPLEVARST
SPSPSLRTPSSSFNFDIAEPAGPQRNRPFCLPLNLPRDDLLPPLDQPLPTRDWVTIEGDF
VLVLALYQTHLGADLYAAPQARFDDGLIHLTFVRAGISRATLLRLFFAMERGTHHSVSSP
YVSHVTCRAFRLQPLSTRGTLTVDGELVPYGPLQAQVGKPLDICSDSPVIFLE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaccggaaccgtcttcaccctccacagcagaagcccttctccacagccagttt
gccagctggggctcccacggcagcggcagcggtaacaacaacagctgccccaacagcccc
ggtggtcaggtggggctatcgcctgctgcctctcctacccccagtctggcctccaactat
gcgctgaccctcacccacacccacatacacatccagcgtctggcgacccgctcggggaag
gaagcccgcctcatgctgcctttggcggagctggtgggttgcagctgcccccgggcccct
gcgcccccactgttggtgctgtactggtaccccccggggaagaagcggaaaggggtgtct
cggcgccggcaggtcagggcctacctggccgagagcaggaccgaagcagagcgatgggca
gccgccgtgcagtgtctgctcagagacgtgaccgtgaccgccgacacagaattttcaaga
cgcttgctacctcgtcccaggcgactcatgttattggtgaaccccttcagtgggagaggc
caggccatgcagtggtgtcagacccagatcctcccgatgatcagggaggccaacatcagc
tacaacctcatccagacagagcggcagaaccacgcccgagagctgatccgagagatctcg
ctgcccgagtgggacggcatcgtcattgtttcgggggacggcctcctgcacgaggtgatc
aatgggctgatggagcgtccggattgggaacaagcaataaagatacctgttggtattctg
ccctgtggatctggcaatgcactggccggctcaatcaaccacaacgcagggtatgacatg
tgccttcgggagtccctccttctaaactgctgctttttactctgccgcggcggcgtgcgt
ccgatggatgttgtatccgtgacaaccagccctcctccatcgagcaacaatcatcccgca
gcacccaaaagactgttttctttcctttctgtcgcctggggtttcgtgtctgatgtggac
atcgagagcgagaggtatcgcggactgggctcggctcgttttacgctgggcactctggtg
cggatagcttccctccgatcctacaagggtcgcctgtccttcttgccccccagctgtacc
tcatccccggatgccacgccacctccgccccggagggccctctcccgaagcatcacagag
ggcctggagggcttctgccggccacccatacatcgaacatgctctgatatgggcatcagt
gaacaacggagcctgcgcaggggtgaaggagagtgggaaagagacgagcggcagagagag
agggagaggaggagggagagggctcggggtggaggaaccggtgtggtgagggcgagcagc
ctggcagaggacagagagaaggaggaaaggttggcggtgatcaaggatgaaagggaaaat
aagggaaacgcgcaggaggaggacgaggacggaggacaggacggccgagggagggtccag
tctgatgggaaagaaggagcactgccccctgacaagccgggggacggctgcgaggttgat
atggggaaagaggcagatgagcaggtcgacagcccttatcaggatgaacttcagggtgtc
agacaggctctgagaaagaattcagccccttcgagtcagatcagcagtgccctcttcaac
cagccactcgggcaggtgacctgcccggactctaatgcctcatatggggtggaagacatg
gacctgaatggaacgtactaccagaaagaagcctacccactggaagtggctcgttccacc
tcgccctcgccctcgctgcgcaccccttcctcatcctttaactttgacatcgctgagcca
gcaggaccccaaaggaaccgtccgttctgcctgcctttaaatcttcctagagatgacttg
ttgccgcctcttgaccaaccccttcccaccagggactgggtcacaatagaaggtgacttt
gtcctggttcttgccctttaccagacccacctcggggccgacctttatgctgcaccccaa
gccagattcgacgacgggctgatccacctgaccttcgtgcgggcggggatctccagagcc
actctgctaagacttttctttgccatggagagaggaactcatcactccgtcagctcgcca
tatgtgagtcatgtgacttgcagggccttcaggctgcagcctctgtcgacacgcgggacg
ctcacggtggatggagaactggtcccctatggaccgcttcaggcacaggtcgggaaacct
cttgatatctgttctgactctccggtcatctttctggaatag

DBGET integrated database retrieval system