KEGG   Takifugu rubripes (torafugu): 101078125Help
Entry
101078125         CDS       T02386                                 

Gene name
sphk2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    101078125 (sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101078125 (sphk2)
   04371 Apelin signaling pathway
    101078125 (sphk2)
   04020 Calcium signaling pathway
    101078125 (sphk2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101078125 (sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 889 aa AA seqDB search
MRSPEPSSPSTAEALLHSQFASWGSHGSGSGNNNSCPNSPGGQVGLSPAASPTPSLASNY
ALTLTHTHIHIQRLATRSGKEARLMLPLAELVGCSCPRAPAPPLLVLYWYPPGKKRKGVS
RRRQVRAYLAESRTEAERWAAAVQCLLRDVTVTADTEFSRRLLPRPRRLMLLVNPFSGRG
QAMQWCQTQILPMIREANISYNLIQTERQNHARELIREISLPEWDGIVIVSGDGLLHEVI
NGLMERPDWEQAIKIPVGILPCGSGNALAGSINHNAGYDMCLRESLLLNCCFLLCRGGVR
PMDVVSVTTSPPPSSNNHPAAPKRLFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLV
RIASLRSYKGRLSFLPPSCTSSPDATPPPPRRALSRSITEGLEGFCRPPIHRTCSDMGIS
EQRSLRRGEGEWERDERQRERERRRERARGGGTGVVRASSLAEDREKEGEGEVEMEAEEE
RSGTSSESNERDECGMERVERLAVIKDERENKGNAQEEDEDGGQDGRGRVQSDGKEGALP
PDKPGDGCEVDMGKEADEQVDSPYQDELQGVRQALRKNSAPSSQISSALFNQPLGQVTCP
DSNASYGVEDMDLNGTYYQKEAYPLEVARERALTISSPFRHSPFSYKPKSLDQNQNSRPR
PLSLLQHSHSNSLPPKLSSLSLSLSPTPPSSPSCASPHSSSYLLPRPNTPGSTSPSPSLR
TPSSSFNFDIAEPAGPQRNRPFCLPLNLPRDDLLPPLDQPLPTRDWVTIEGDFVLVLALY
QTHLGADLYAAPQARFDDGLIHLTFVRAGISRATLLRLFFAMERGTHHSVSSPYVSHVTC
RAFRLQPLSTRGTLTVDGELVPYGPLQAQVHPSMARLIVGDSGVRITRF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaccggaaccgtcttcaccctccacagcagaagcccttctccacagccagttt
gccagctggggctcccacggcagcggcagcggtaacaacaacagctgccccaacagcccc
ggtggtcaggtggggctatcgcctgctgcctctcctacccccagtctggcctccaactat
gcgctgaccctcacccacacccacatacacatccagcgtctggcgacccgctcggggaag
gaagcccgcctcatgctgcctttggcggagctggtgggttgcagctgcccccgggcccct
gcgcccccactgttggtgctgtactggtaccccccggggaagaagcggaaaggggtgtct
cggcgccggcaggtcagggcctacctggccgagagcaggaccgaagcagagcgatgggca
gccgccgtgcagtgtctgctcagagacgtgaccgtgaccgccgacacagaattttcaaga
cgcttgctacctcgtcccaggcgactcatgttattggtgaaccccttcagtgggagaggc
caggccatgcagtggtgtcagacccagatcctcccgatgatcagggaggccaacatcagc
tacaacctcatccagacagagcggcagaaccacgcccgagagctgatccgagagatctcg
ctgcccgagtgggacggcatcgtcattgtttcgggggacggcctcctgcacgaggtgatc
aatgggctgatggagcgtccggattgggaacaagcaataaagatacctgttggtattctg
ccctgtggatctggcaatgcactggccggctcaatcaaccacaacgcagggtatgacatg
tgccttcgggagtccctccttctaaactgctgctttttactctgccgcggcggcgtgcgt
ccgatggatgttgtatccgtgacaaccagccctcctccatcgagcaacaatcatcccgca
gcacccaaaagactgttttctttcctttctgtcgcctggggtttcgtgtctgatgtggac
atcgagagcgagaggtatcgcggactgggctcggctcgttttacgctgggcactctggtg
cggatagcttccctccgatcctacaagggtcgcctgtccttcttgccccccagctgtacc
tcatccccggatgccacgccacctccgccccggagggccctctcccgaagcatcacagag
ggcctggagggcttctgccggccacccatacatcgaacatgctctgatatgggcatcagt
gaacaacggagcctgcgcaggggtgaaggagagtgggaaagagacgagcggcagagagag
agggagaggaggagggagagggctcggggtggaggaaccggtgtggtgagggcgagcagc
ctggcagaggacagagagaaggagggcgagggggaggtggagatggaggcagaagaggag
aggtctgggacgagttccgagtcaaacgaaagggatgaatgcggtatggaaagggtagaa
aggttggcggtgatcaaggatgaaagggaaaataagggaaacgcgcaggaggaggacgag
gacggaggacaggacggccgagggagggtccagtctgatgggaaagaaggagcactgccc
cctgacaagccgggggacggctgcgaggttgatatggggaaagaggcagatgagcaggtc
gacagcccttatcaggatgaacttcagggtgtcagacaggctctgagaaagaattcagcc
ccttcgagtcagatcagcagtgccctcttcaaccagccactcgggcaggtgacctgcccg
gactctaatgcctcatatggggtggaagacatggacctgaatggaacgtactaccagaaa
gaagcctacccactggaagtggctcgtgagcgagctctcaccatctcctctccctttcgt
cactctcccttctcttacaagcccaagtccctggaccaaaaccagaactctcggccaagg
cccctctccctcctccagcactcccactcaaattccctgcccccgaaactctcctctctc
tctctgtctctctctcctacgcccccatcttctccttcctgtgcctccccgcactcctca
tcctacctccttccccgtccaaacaccccaggttccacctcgccctcgccctcgctgcgc
accccttcctcatcctttaactttgacatcgctgagccagcaggaccccaaaggaaccgt
ccgttctgcctgcctttaaatcttcctagagatgacttgttgccgcctcttgaccaaccc
cttcccaccagggactgggtcacaatagaaggtgactttgtcctggttcttgccctttac
cagacccacctcggggccgacctttatgctgcaccccaagccagattcgacgacgggctg
atccacctgaccttcgtgcgggcggggatctccagagccactctgctaagacttttcttt
gccatggagagaggaactcatcactccgtcagctcgccatatgtgagtcatgtgacttgc
agggccttcaggctgcagcctctgtcgacacgcgggacgctcacggtggatggagaactg
gtcccctatggaccgcttcaggcacaggttcacccttccatggctcgtctcatcgttggc
gactcaggagtgaggattactagattctag

DBGET integrated database retrieval system