KEGG   Takifugu rubripes (torafugu): 101078125Help
Entry
101078125         CDS       T02386                                 

Gene name
sphk2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101078125 (sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101078125 (sphk2)
   04020 Calcium signaling pathway
    101078125 (sphk2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     101078125 (sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 889 aa AA seqDB search
MRSPEPSSPSTAEALLHSQFASWGSHGSGSGNNNSCPNSPGGQVGLSPAASPTPSLASNY
ALTLTHTHIHIQRLATRSGKEARLMLPLAELVGCSCPRAPAPPLLVLYWYPPGKKRKGVS
RRRQVRAYLAESRTEAERWAAAVQCLLRDVTVTADTEFSRRLLPRPRRLMLLVNPFSGRG
QAMQWCQTQILPMIREANISYNLIQTERQNHARELIREISLPEWDGIVIVSGDGLLHEVI
NGLMERPDWEQAIKIPVGILPCGSGNALAGSINHNAGYDMCLRESLLLNCCFLLCRGGVR
PMDVVSVTTSPPPSSNNHPAAPKRLFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLV
RIASLRSYKGRLSFLPPSCTSSPDATPPPPRRALSRSITEGLEGFCRPPIHRTCSDMGIS
EQRSLRRGEGEWERDERQRERERRRERARGGGTGVVRASSLAEDREKEGEGEVEMEAEEE
RSGTSSESNERDECGMERVERLAVIKDERENKGNAQEEDEDGGQDGRGRVQSDGKEGALP
PDKPGDGCEVDMGKEADEQVDSPYQDELQGVRQALRKNSAPSSQISSALFNQPLGQVTCP
DSNASYGVEDMDLNGTYYQKEAYPLEVARERALTISSPFRHSPFSYKPKSLDQNQNSRPR
PLSLLQHSHSNSLPPKLSSLSLSLSPTPPSSPSCASPHSSSYLLPRPNTPGSTSPSPSLR
TPSSSFNFDIAEPAGPQRNRPFCLPLNLPRDDLLPPLDQPLPTRDWVTIEGDFVLVLALY
QTHLGADLYAAPQARFDDGLIHLTFVRAGISRATLLRLFFAMERGTHHSVSSPYVSHVTC
RAFRLQPLSTRGTLTVDGELVPYGPLQAQVHPSMARLIVGDSGVRITRF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaccggaaccgtcttcaccctccacagcagaagcccttctccacagccagttt
gccagctggggctcccacggcagcggcagcggtaacaacaacagctgccccaacagcccc
ggtggtcaggtggggctatcgcctgctgcctctcctacccccagtctggcctccaactat
gcgctgaccctcacccacacccacatacacatccagcgtctggcgacccgctcggggaag
gaagcccgcctcatgctgcctttggcggagctggtgggttgcagctgcccccgggcccct
gcgcccccactgttggtgctgtactggtaccccccggggaagaagcggaaaggggtgtct
cggcgccggcaggtcagggcctacctggccgagagcaggaccgaagcagagcgatgggca
gccgccgtgcagtgtctgctcagagacgtgaccgtgaccgccgacacagaattttcaaga
cgcttgctacctcgtcccaggcgactcatgttattggtgaaccccttcagtgggagaggc
caggccatgcagtggtgtcagacccagatcctcccgatgatcagggaggccaacatcagc
tacaacctcatccagacagagcggcagaaccacgcccgagagctgatccgagagatctcg
ctgcccgagtgggacggcatcgtcattgtttcgggggacggcctcctgcacgaggtgatc
aatgggctgatggagcgtccggattgggaacaagcaataaagatacctgttggtattctg
ccctgtggatctggcaatgcactggccggctcaatcaaccacaacgcagggtatgacatg
tgccttcgggagtccctccttctaaactgctgctttttactctgccgcggcggcgtgcgt
ccgatggatgttgtatccgtgacaaccagccctcctccatcgagcaacaatcatcccgca
gcacccaaaagactgttttctttcctttctgtcgcctggggtttcgtgtctgatgtggac
atcgagagcgagaggtatcgcggactgggctcggctcgttttacgctgggcactctggtg
cggatagcttccctccgatcctacaagggtcgcctgtccttcttgccccccagctgtacc
tcatccccggatgccacgccacctccgccccggagggccctctcccgaagcatcacagag
ggcctggagggcttctgccggccacccatacatcgaacatgctctgatatgggcatcagt
gaacaacggagcctgcgcaggggtgaaggagagtgggaaagagacgagcggcagagagag
agggagaggaggagggagagggctcggggtggaggaaccggtgtggtgagggcgagcagc
ctggcagaggacagagagaaggagggcgagggggaggtggagatggaggcagaagaggag
aggtctgggacgagttccgagtcaaacgaaagggatgaatgcggtatggaaagggtagaa
aggttggcggtgatcaaggatgaaagggaaaataagggaaacgcgcaggaggaggacgag
gacggaggacaggacggccgagggagggtccagtctgatgggaaagaaggagcactgccc
cctgacaagccgggggacggctgcgaggttgatatggggaaagaggcagatgagcaggtc
gacagcccttatcaggatgaacttcagggtgtcagacaggctctgagaaagaattcagcc
ccttcgagtcagatcagcagtgccctcttcaaccagccactcgggcaggtgacctgcccg
gactctaatgcctcatatggggtggaagacatggacctgaatggaacgtactaccagaaa
gaagcctacccactggaagtggctcgtgagcgagctctcaccatctcctctccctttcgt
cactctcccttctcttacaagcccaagtccctggaccaaaaccagaactctcggccaagg
cccctctccctcctccagcactcccactcaaattccctgcccccgaaactctcctctctc
tctctgtctctctctcctacgcccccatcttctccttcctgtgcctccccgcactcctca
tcctacctccttccccgtccaaacaccccaggttccacctcgccctcgccctcgctgcgc
accccttcctcatcctttaactttgacatcgctgagccagcaggaccccaaaggaaccgt
ccgttctgcctgcctttaaatcttcctagagatgacttgttgccgcctcttgaccaaccc
cttcccaccagggactgggtcacaatagaaggtgactttgtcctggttcttgccctttac
cagacccacctcggggccgacctttatgctgcaccccaagccagattcgacgacgggctg
atccacctgaccttcgtgcgggcggggatctccagagccactctgctaagacttttcttt
gccatggagagaggaactcatcactccgtcagctcgccatatgtgagtcatgtgacttgc
agggccttcaggctgcagcctctgtcgacacgcgggacgctcacggtggatggagaactg
gtcccctatggaccgcttcaggcacaggttcacccttccatggctcgtctcatcgttggc
gactcaggagtgaggattactagattctag

DBGET integrated database retrieval system