KEGG   Takifugu rubripes (torafugu): 101079470Help
Entry
101079470         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 4-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 1001 aa AA seqDB search
MMAEGGGPESAGAADSDSEPVAGQMPTPSTESQKQTIGSLLKTALRKGDEWYLIDSRWFK
QWKKYVGFDSWDMYNVGERNLYPGPIDNSGLFSDQDTQALKEHLIDELDYVLVPTEAWNK
LISWYSCLDGQRPIVRKVIEHGMFVKHCKVEVYLLELNLCENNNMDIAVTRYFSKADTID
TIEKEMRTLFKIPAEKETRLWNKYMSNTYEQLNKPDSTVQDAGLFHGQVLVIEQKNEDGT
WPRQASHSKSSAASSRNFTTSPKLSSNSASISSTVTNGDNCCSPGYTLNNSSSSGSRLGE
YSSYSSSYSYRESQSHPGLCGLSNLGNTCFMNSALQCLSNASPLTEYFLNDQYEAEINRE
NPLGMRGEIAEAYADLVKQMWLSRSSYVAPRSFKTQVGRFAPQFSGYQQQDSQELLAFLL
DGLHEDLNRVKKKPYLALRDAEGRPDEIVAKEAWTNHRLRNDSIIVDIFHGLFKSTLVCP
ECSKVSVTFDPFCYLTLPLPMKKDRTLEVFLVRSDPQSRPTQYRVVVPKLGTVTDLCCAL
TKLCGVAPENMMVADVYNHRFHKIYRRDDGLNQIMEKDDIFVYEVQEEDGERMNLPVYFR
ERHSKHIGSSTSTVLFGQPLLITVPKHNLIADVLYDKILERIGRYVKHTQSPNSDSRASA
SASFASSSQAAECSTSLGASGSSLSDGASCCAGSSNGSNHTGACSETNGLYDGEEEAMDH
QVSPEPENGHSEEEEASDLENGSKADAIKPCSPPAKLFTFSVVNSYGTANISSLPCDGNV
LQLNPHSTVAIDWDTESKKLHYDEQEAEAYEKHESMLQPQKKKATVALKECIELFTTMET
LGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLN
MSEFVCDPKASPYIYDLIAVSNHYGGMGGGHYTAYGKNKADGKWYYFDDSSVSSASEDQI
VTKAAYVLFYQRRDEESPSKPQPSASLGGAPDAADDHMDTN
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgagggaggcggacccgagtcggctggcgcggcagactccgactcggagccg
gttgctggtcaaatgccaacaccttcaaccgaaagccaaaaacagacaatcgggtctctt
ttgaaaacggctctaagaaagggggacgaatggtatctgatcgacagccggtggttcaaa
caatggaagaagtatgtgggtttcgacagctgggacatgtataacgtcggggagcggaac
ctttatccaggaccaattgataactccgggctgttctcagatcaagatactcaggccctg
aaagagcaccttattgacgagctggactatgtccttgtgccgactgaggcgtggaataaa
ctcatcagctggtacagctgcctggatggccagagacccattgtcaggaaggtcatcgaa
cacggcatgtttgtcaagcactgcaaggtggaagtttacctgctggagctcaacctgtgc
gagaataacaacatggacatcgcggtcacgcgttatttcagtaaagccgataccatcgat
acaatagagaaggagatgaggacgctgtttaagatcccagcagagaaggagacacgcctc
tggaacaaatatatgagcaacacctacgagcagctgaataagccagacagcactgtgcag
gatgctggtctcttccatgggcaggttcttgtgattgagcagaagaatgaggacggcact
tggccaaggcaggcctcccattccaagtccagcgccgcctcgtccaggaacttcactacc
tccccgaaactgtcctccaactccgccagtatttcctcgacggtaaccaacggagacaac
tgctgcagccccggatacactctgaacaacagctcgtcttctggaagcaggcttggggag
tacagttcctacagctcctcctacagctacagagagtcccagtcgcaccccggcctgtgc
ggcctcagcaatttgggcaacacgtgcttcatgaattctgccctccagtgcctgagcaac
gcctcgccgctcaccgagtacttcctcaacgaccagtacgaggcggagatcaacagagag
aatcccctgggaatgaggggcgagatcgccgaggcctacgcagacctggtgaagcagatg
tggctcagccgcagcagctacgtggccccgcgctccttcaaaacacaagttgggcgtttc
gctccgcagttctcgggctaccagcagcaggactcccaggagctgttggccttcctgctg
gatgggctccacgaagatctgaaccgcgtgaaaaagaagccttatcttgccctgagagac
gcggagggacgtcccgatgagattgttgctaaggaggcctggacaaaccatcgcttgcgt
aacgactccataatagttgatattttccatggtcttttcaagtccaccttggtgtgtcca
gagtgctccaaggtgtcggtaacctttgatccgttctgctacctcacgctgcctctcccg
atgaaaaaggatcgaacgttggaggttttcctggtacgctcagaccctcagtccagaccc
acacagtaccgagtggtggtccctaaactgggtactgtcacagatctgtgctgcgccttg
accaaactctgcggtgtcgctccagaaaatatgatggtggcggatgtttataatcacagg
ttccataaaatctacagacgagatgacggcctcaaccaaataatggaaaaagacgacatc
tttgtgtacgaggtgcaggaggaggacggcgagaggatgaacctgcccgtgtatttcagg
gagcgtcactccaaacacatcgggagctccacgagcaccgtgctgtttggccagccttta
ctgatcacggtgcccaaacacaacctcatcgcagacgtcctctatgacaagatcttggag
aggatagggcgttatgtgaaacacactcagagccccaacagcgacagcagggcgtcggcc
tcggcgagcttcgccagcagcagccaggccgccgaatgttccacgtcattgggcgccagc
ggcagctccctctcggacggggcgtcctgctgcgccggctccagcaacggcagcaaccac
acgggggcctgcagcgagaccaacggcctgtacgacggtgaagaggaggcgatggatcac
caggtgagtccggagccagagaacggccactccgaagaggaggaggcctctgacttggag
aatggatcgaaagcagacgccatcaagccgtgttcgcctccagccaaactgttcacgttc
agcgtcgtcaactcttacgggacggctaacatcagctcgctgccctgtgatggaaacgtc
ctccagcttaacccccactctaccgtggccatcgactgggacacggagtcaaagaagctg
cattacgacgagcaggaagctgaggcctacgagaaacatgagagcatgctgcagccgcag
aagaagaaagccacagtggccctgaaggagtgcatcgagctctttacgaccatggagaca
ctcggagaacacgacccctggtactgtccaacatgtaagaaacaccaacaagccaccaaa
aagtttgatctgtggtcgctgccacgcattctggtggttcacctgaagagattctcctac
aatcggtgttggagggacaaattggacacagtggtggactttcccatcagggatttgaac
atgtctgagtttgtgtgcgaccccaaggccagcccctacatatacgacctcattgctgtc
tcaaaccactacggaggaatgggagggggtcactacacagcttacggcaagaacaaagct
gatggaaagtggtattactttgacgacagcagcgtgtcctctgcctccgaggatcagatt
gtgactaaagcggcctacgtgctgttctaccagcgcagagacgaggaatcgccttccaaa
cctcagccgtcagcctccctcggtggagccccggatgcggccgatgaccacatggacaca
aactga

DBGET integrated database retrieval system