KEGG   Trichinella spiralis: Tsp_09960Help
Entry
Tsp_09960         CDS       T01609                                 

Definition
putative PAP2 family protein
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
tsp  Trichinella spiralis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsp_09960
   00052 Galactose metabolism
    Tsp_09960
   00500 Starch and sucrose metabolism
    Tsp_09960
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Tsp_09960
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Tsp_09960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 348 aa AA seqDB search
MEAMHKYGVSFELWLQESLQGQAERFLSITKVGDPDLLILYLLPFLSAINRSLFLRMLHG
ERPYWWIHSSGAYEVVPALQQFPLTCETGPGSPSGHAMITASVWYIIVWGYVTFIVGRSR
KRAILTKSAWLIYLLLLIMVAVSRLYIATHFPHQVMLGSIIGFVIGVYFTRFPVEMLRMK
HCFALAIVLVTTAFLVYVFMILLGVEPDWSVKMAMKWCQNREWVHLNTTPLNALFRDTGA
IIGLGLAVESRYFLQTLHNMHRDGSEVITALVTFILVQCCACIPRSSHHLGLYYLGTFVQ
NCCISFGSVALVPYVVKMIWNLNQMPDANAEPKKDLLHRSRRKLTACF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaatgcacaagtacggtgtgagctttgagctatggctgcaagaatcgcttcaa
ggacaggctgaacgtttcttgagtatcacaaaagttggcgatccagatttgctaattctc
tacttgcttccgttcttatcggcaataaatcgatctctttttctacggatgttacacgga
gaaagaccttattggtggatacatagcagtggagcttatgaagttgttcctgctcttcag
cagtttcctttaacctgcgaaaccggtccaggaagtccaagtggtcatgcaatgattaca
gcatctgtttggtatatcattgtatggggatatgtgacatttattgttggaagatcacgg
aaacgagccattcttaccaaatccgcttggttaatctacttgttattgcttattatggta
gctgtttcaagactttacattgcaactcactttccacatcaggttatgcttggatctatt
attggattcgtaattggtgtgtattttacgcgttttcccgtcgaaatgcttcgtatgaaa
cattgctttgctctcgctattgttctcgttactacagcattccttgtttacgtatttatg
attcttttgggtgtcgaacccgactggtcagttaaaatggcaatgaaatggtgccagaat
cgagaatgggtccatttgaatacgacacctttgaacgcgctgttccgcgatacaggtgca
attattggcctcggattggcggttgagtctcgttattttcttcaaacattgcacaacatg
catcgcgacggaagtgaagtgatcactgctttggttacatttatattagtgcagtgctgc
gcttgcataccaagatcttctcatcatctcggactttattatttgggaacatttgtgcaa
aattgttgtatatcatttggatcagtcgctctggtaccgtacgtggtgaaaatgatttgg
aatttgaatcaaatgcctgatgcaaatgcagaacctaaaaaagatctgttgcatcggagt
cgccggaagctgactgcctgtttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system